close

SimulationCraft 801-02

for World of Warcraft 8.0.1 Live (wow build level 27980)

Current simulator hotfixes

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Nether Portal duration 15000.00 20000.00
Nether Portal cast_max 0.00 2500.00
Demonic Consumption (effect#1) base_value 3.00 1.00
Demonfire (effect#1) sp_coefficient 0.36 0.33
From the Shadows (effect#1) base_value 50.00 20.00
Bilescourge Bombers (effect#1) sp_coefficient 0.19 0.14
Firebolt (effect#1) sp_coefficient 0.57 0.40
Shadow Bite (effect#1) sp_coefficient 0.51 0.30
Lash of Pain (effect#1) sp_coefficient 0.51 0.30
Consuming Shadows (effect#1) sp_coefficient 0.10 0.07
Legion Strike (effect#1) ap_coefficient 0.97 0.68
Grimoire of Service (effect#1) base_value 15.00 25.00
Demonology Warlock (effect#1) base_value 5.00 10.00
Demonology Warlock (effect#2) base_value 5.00 10.00
Demonology Warlock (effect#3) base_value 5.00 10.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

DL_GF_Felguard : 17285 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17285.2 17285.2 15.7 / 0.091% 2245.8 / 13.0% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.6 954.5 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_GF_Felguard 17285
Demonbolt 1255 7.3% 44.2 6.21sec 8521 7489 Direct 45.0 7110 14217 8362 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.21 45.05 0.00 0.00 1.1379 0.0000 376711.28 376711.28 0.00 7488.99 7488.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.11 82.38% 7110.35 6520 8308 7111.46 6903 7319 263876 263876 0.00
crit 7.94 17.62% 14216.96 13040 16616 14218.43 0 16616 112835 112835 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1052 6.1% 60.4 4.89sec 5220 4737 Direct 60.3 4450 8881 5231 17.6%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.44 60.32 0.00 0.00 1.1019 0.0000 315506.30 315506.30 0.00 4737.40 4737.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.69 82.38% 4450.30 1634 5979 4443.97 4012 4810 221134 221134 0.00
crit 10.63 17.62% 8880.73 3267 11958 8862.35 0 10940 94372 94372 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 36.35sec 8269 0 Direct 7.3 4925 9849 5779 17.4%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 7.35 0.00 0.00 0.0000 0.0000 42449.86 42449.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.07 82.64% 4924.62 4925 4925 4924.62 4925 4925 29894 29894 0.00
crit 1.27 17.36% 9849.24 9849 9849 7120.46 0 9849 12556 12556 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.4% 7.3 36.35sec 2489 0 Direct 7.3 2111 4221 2489 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.35 7.35 0.00 0.00 0.0000 0.0000 18285.26 18285.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.05% 2110.55 2111 2111 2108.86 0 2111 12719 12719 0.00
crit 1.32 17.95% 4221.10 4221 4221 3091.31 0 4221 5566 5566 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1340 7.8% 95.7 3.05sec 4199 2811 Direct 95.0 3595 7189 4229 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.72 95.03 0.00 0.00 1.4937 0.0000 401918.45 401918.45 0.00 2811.15 2811.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.25 82.34% 3594.68 3373 4297 3595.22 3550 3652 281284 281284 0.00
crit 16.78 17.66% 7188.82 6745 8595 7189.75 6912 7548 120634 120634 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 37.11sec 11880 0 Direct 7.2 10240 20481 12040 17.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.21 0.00 0.00 0.0000 0.0000 86817.38 86817.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.44% 10240.44 10240 10240 10236.34 0 10240 60875 60875 0.00
crit 1.27 17.56% 20480.88 20481 20481 14704.12 0 20481 25942 25942 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3164 / 3164
Felstorm 378 2.2% 10.4 30.14sec 10883 2889 Periodic 62.1 1553 3105 1825 17.6% 13.1%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.41 0.00 62.10 62.10 3.7673 0.6318 113335.80 162027.14 30.05 2888.86 2888.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.2 82.45% 1552.80 1454 1910 1552.77 1525 1598 79501 113656 30.05
crit 10.9 17.55% 3104.71 2908 3820 3105.02 2951 3639 33835 48372 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1061 6.1% 58.4 5.09sec 5443 5419 Direct 58.4 4625 9253 5443 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.42 58.42 0.00 0.00 1.0045 0.0000 317984.12 454596.49 30.05 5418.95 5418.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.09 82.32% 4625.16 4179 5592 4625.89 4509 4740 222428 317988 30.05
crit 10.33 17.68% 9253.18 8359 11183 9255.08 8552 10597 95556 136609 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1725 10.0% 173.7 1.71sec 2977 2008 Direct 173.7 2529 5059 2977 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.69 173.69 0.00 0.00 1.4822 0.0000 517023.67 739147.43 30.05 2008.36 2008.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.93 82.29% 2528.80 2284 3056 2529.22 2491 2573 361454 516742 30.05
crit 30.75 17.71% 5058.83 4569 6113 5059.27 4764 5390 155570 222406 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - grimoire_felguard 4762 / 1031
Felstorm 653 0.8% 3.9 80.77sec 10647 3638 Periodic 19.5 1829 3660 2156 17.8% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.47 19.47 2.9270 0.5926 41983.58 60020.56 30.05 3637.78 3637.78
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.17% 1829.36 1715 2197 1829.94 1770 1985 29273 41850 30.05
crit 3.5 17.83% 3659.80 3430 4393 3577.20 0 4393 12710 18171 29.36
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1848 2.3% 18.5 13.91sec 6446 6447 Direct 18.5 5477 10953 6446 17.7%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.45 18.45 0.00 0.00 1.0000 0.0000 118960.65 170068.53 30.05 6446.68 6446.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.19 82.30% 5476.93 5020 6430 5479.72 5226 5924 83180 118916 30.05
crit 3.27 17.70% 10953.44 10040 12861 10661.01 0 12249 35780 51152 29.25
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2261 2.8% 40.9 6.34sec 3553 3004 Direct 40.9 3020 6042 3553 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.94 40.94 0.00 0.00 1.1828 0.0000 145472.46 207970.36 30.05 3003.71 3003.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.72 82.37% 3020.12 2744 3515 3021.08 2933 3220 101854 145613 30.05
crit 7.22 17.63% 6041.67 5488 7030 6041.50 0 6733 43618 62358 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - void_terror 1835 / 249
Double Breath 0 (135) 0.0% (0.8%) 0.0 0.00sec 0 7402

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7402.16 7402.16
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 495 0.4% 7.1 17.49sec 2805 0 Direct 7.1 2389 4773 2805 17.5%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.12 7.12 0.00 0.00 0.0000 0.0000 19978.46 19978.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.88 82.54% 2389.13 2116 2582 2389.29 0 2582 14044 14044 0.00
crit 1.24 17.46% 4773.43 4233 5163 3210.00 0 5163 5935 5935 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 496 0.4% 7.1 17.49sec 2810 0 Direct 7.1 2388 4784 2810 17.6%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.12 7.12 0.00 0.00 0.0000 0.0000 20008.03 20008.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.87 82.41% 2387.95 2116 2582 2385.62 0 2582 14014 14014 0.00
crit 1.25 17.59% 4784.47 4233 5163 3273.70 0 5163 5994 5994 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 844 0.7% 43.2 2.69sec 783 666 Direct 43.2 665 1331 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.23 43.23 0.00 0.00 1.1763 0.0000 33860.63 48407.83 30.05 665.87 665.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.53 82.20% 664.66 587 717 665.64 587 714 23617 33764 30.05
crit 7.70 17.80% 1330.85 1175 1433 1313.87 0 1433 10243 14644 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - urzul 1329 / 178
Many Faced Bite 494 0.4% 9.4 12.44sec 2112 2112 Direct 9.4 1793 3584 2112 17.8%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.36 9.36 0.00 0.00 1.0000 0.0000 19764.92 28256.32 30.05 2111.86 2111.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.69 82.21% 1792.90 1586 1935 1791.96 0 1935 13795 19722 29.98
crit 1.67 17.79% 3584.12 3172 3870 2721.99 0 3870 5970 8534 22.81
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 834 0.6% 42.3 2.66sec 783 666 Direct 42.3 665 1330 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.26 42.26 0.00 0.00 1.1760 0.0000 33089.88 47305.95 30.05 665.75 665.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.76 82.25% 664.90 587 717 665.61 587 714 23114 33045 30.05
crit 7.50 17.75% 1329.99 1175 1433 1314.28 0 1433 9976 14261 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3211 / 1516
Bile Spit 1170 3.2% 6.8 47.24sec 24326 0 Direct 6.8 8932 17857 10545 18.1%  
Periodic 33.1 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.77 6.76 33.13 33.13 0.0000 2.0000 164793.37 164793.37 0.00 2487.15 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.54 81.94% 8931.87 8474 10104 8930.66 8646 9664 49486 49486 0.00
crit 1.22 18.06% 17856.71 16947 20207 13195.36 0 20207 21804 21804 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.1 100.00% 2822.40 2502 3310 2823.18 2633 2885 93504 93504 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 733 2.0% 28.5 10.26sec 3649 3649 Direct 28.5 3106 6212 3649 17.5%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.46 28.46 0.00 0.00 1.0000 0.0000 103850.46 148466.71 30.05 3649.25 3649.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.48 82.51% 3105.88 2737 3621 3107.24 2940 3247 72925 104255 30.05
crit 4.98 17.49% 6211.60 5474 7243 6181.20 0 7243 30926 44212 29.89
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1307 3.6% 102.6 2.81sec 1802 1354 Direct 102.6 1531 3064 1802 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.62 102.62 0.00 0.00 1.3304 0.0000 184888.89 264320.87 30.05 1354.29 1354.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.47 82.31% 1530.52 1337 1775 1531.10 1481 1566 129277 184816 30.05
crit 18.15 17.69% 3063.53 2673 3550 3064.61 2784 3392 55612 79504 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1069 / 145
Demon Fangs 660 0.5% 9.4 12.35sec 2823 2823 Direct 9.4 2393 4792 2823 17.9%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.37 9.37 0.00 0.00 1.0000 0.0000 26440.83 26440.83 0.00 2823.06 2823.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.69 82.07% 2392.81 2116 2582 2393.48 0 2582 18393 18393 0.00
crit 1.68 17.93% 4791.52 4233 5163 3670.64 0 5163 8048 8048 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 409 0.3% 83.1 1.34sec 196 326 Direct 83.1 167 333 196 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.09 83.09 0.00 0.00 0.6006 0.0000 16274.25 23266.00 30.05 326.08 326.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.48 82.42% 166.58 147 179 166.71 147 178 11408 16309 30.05
crit 14.61 17.58% 333.06 294 358 332.87 0 358 4866 6957 30.01
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - dreadstalker 3641 / 2405
Dreadbite 1335 5.1% 29.1 20.93sec 9082 0 Direct 29.1 7718 15444 9081 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.09 29.09 0.00 0.00 0.0000 0.0000 264201.46 264201.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.96 82.35% 7717.82 7139 9517 7718.46 7442 8067 184899 184899 0.00
crit 5.13 17.65% 15444.09 14278 19033 15379.77 0 19033 79302 79302 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2306 8.8% 312.1 1.89sec 1464 1106 Direct 312.1 1244 2488 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.14 312.14 0.00 0.00 1.3234 0.0000 456869.03 653149.14 30.05 1106.02 1106.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.97 82.33% 1243.67 1101 1473 1243.84 1225 1263 319586 456887 30.05
crit 55.17 17.67% 2488.35 2203 2947 2488.84 2372 2612 137283 196262 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - illidari_satyr 1274 / 171
melee 422 0.3% 42.7 2.62sec 391 333 Direct 42.7 332 665 391 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 1.1734 0.0000 16677.43 23842.38 30.05 333.24 333.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.15 82.42% 332.50 294 358 332.90 294 357 11689 16710 30.05
crit 7.50 17.58% 665.37 587 717 655.40 0 717 4989 7132 29.57
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 211 0.2% 42.7 2.62sec 196 158 Direct 42.7 166 332 196 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 1.2408 0.0000 8351.85 11939.98 30.05 157.81 157.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.07 82.22% 166.27 147 179 166.47 147 178 5831 8336 30.05
crit 7.58 17.78% 332.47 294 358 328.60 0 358 2521 3604 29.67
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 641 0.5% 9.1 12.66sec 2815 2815 Direct 9.1 2396 4791 2815 17.5%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.09 9.09 0.00 0.00 1.0000 0.0000 25579.64 25579.64 0.00 2815.28 2815.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.50 82.52% 2396.27 2116 2582 2395.97 0 2582 17968 17968 0.00
crit 1.59 17.48% 4791.09 4233 5163 3559.50 0 5163 7612 7612 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wild_imp 2580 / 2479
Fel Firebolt 2580 14.4% 996.3 0.29sec 747 502 Direct 992.1 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 996.26 992.12 0.00 0.00 1.4872 0.0000 743762.66 743762.66 0.00 502.00 502.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 816.81 82.33% 637.07 569 761 637.09 627 649 520364 520364 0.00
crit 175.31 17.67% 1274.28 1138 1523 1274.33 1234 1323 223398 223398 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4663 / 824
Demonfire 4663 4.8% 37.8 6.90sec 6531 4892 Direct 37.7 5561 11122 6544 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.77 37.69 0.00 0.00 1.3350 0.0000 246671.98 246671.98 0.00 4892.05 4892.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.03 82.31% 5560.69 5312 5917 5564.03 5465 5676 172527 172527 0.00
crit 6.67 17.69% 11122.30 10624 11834 11118.38 0 11834 74145 74145 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - shivarra 1945 / 261
melee 841 0.6% 42.6 2.71sec 783 667 Direct 42.6 665 1330 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.55 42.55 0.00 0.00 1.1744 0.0000 33324.66 47641.61 30.05 666.80 666.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.00 82.26% 665.09 587 717 665.92 587 714 23281 33283 30.05
crit 7.55 17.74% 1330.28 1175 1433 1314.72 0 1433 10044 14359 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 420 0.3% 42.6 2.71sec 391 315 Direct 42.6 333 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.55 42.55 0.00 0.00 1.2420 0.0000 16659.43 23816.66 30.05 315.22 315.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.01 82.27% 332.57 294 358 332.97 294 357 11643 16646 30.05
crit 7.54 17.73% 664.87 587 717 657.35 0 717 5016 7171 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (92) 0.0% (0.5%) 0.0 0.00sec 0 3972

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3971.86 3971.86
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 171 0.1% 6.9 18.14sec 992 0 Direct 6.9 844 1689 992 17.5%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 0.0000 0.0000 6809.32 9734.74 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.66 82.51% 843.98 749 914 841.55 0 914 4781 6835 29.90
crit 1.20 17.49% 1689.18 1498 1827 1122.62 0 1827 2028 2900 19.95
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 171 0.1% 6.9 18.14sec 993 0 Direct 6.9 844 1688 993 17.7%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 0.0000 0.0000 6818.09 9747.27 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.65 82.35% 844.08 749 914 841.45 0 914 4772 6822 29.90
crit 1.21 17.65% 1688.30 1498 1827 1130.35 0 1827 2046 2925 20.11
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 172 0.1% 6.9 18.14sec 996 0 Direct 6.9 844 1687 996 18.0%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 0.0000 0.0000 6836.58 9773.71 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.63 82.01% 844.24 749 914 840.58 0 914 4754 6796 29.86
crit 1.23 17.99% 1686.85 1498 1827 1144.05 0 1827 2083 2978 20.37
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 171 0.1% 6.9 18.14sec 991 0 Direct 6.9 844 1689 991 17.4%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.87 6.87 0.00 0.00 0.0000 0.0000 6802.87 9725.52 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.67 82.62% 843.97 749 914 841.46 0 914 4787 6844 29.91
crit 1.19 17.38% 1689.33 1498 1827 1123.62 0 1827 2016 2881 19.97
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1303 / 176
Fel Bite 467 0.4% 8.9 13.44sec 2113 2113 Direct 8.9 1796 3589 2113 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.88 8.88 0.00 0.00 1.0000 0.0000 18767.54 26830.45 30.05 2112.75 2112.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.31 82.32% 1795.53 1586 1935 1796.49 0 1935 13129 18770 30.01
crit 1.57 17.68% 3589.16 3172 3870 2669.71 0 3870 5638 8061 22.33
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 836 0.6% 42.6 2.72sec 783 666 Direct 42.6 665 1329 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.58 42.58 0.00 0.00 1.1752 0.0000 33317.41 47631.24 30.05 665.87 665.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.04 82.29% 664.91 587 717 665.58 587 714 23297 33306 30.05
crit 7.54 17.71% 1329.22 1175 1433 1312.06 0 1433 10020 14325 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wrathguard 1719 / 231
melee 835 0.6% 42.3 2.53sec 783 664 Direct 42.3 665 1330 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.26 42.26 0.00 0.00 1.1787 0.0000 33097.45 47316.77 30.05 664.41 664.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.73 82.19% 664.62 587 717 665.43 587 714 23085 33003 30.05
crit 7.53 17.81% 1330.03 1175 1433 1313.63 0 1433 10012 14313 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 416 0.3% 42.3 2.53sec 391 314 Direct 42.3 332 664 391 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.26 42.26 0.00 0.00 1.2459 0.0000 16516.69 23612.58 30.05 313.68 313.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.82 82.40% 332.39 294 358 332.78 294 357 11575 16547 30.05
crit 7.44 17.60% 664.27 587 717 655.99 0 717 4942 7065 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.9 12.53sec 2112 2112 Direct 8.9 1795 3588 2112 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.86 8.86 0.00 0.00 1.0000 0.0000 18706.63 26743.38 30.05 2111.83 2111.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.29 82.31% 1794.56 1586 1935 1792.05 0 1935 13085 18706 29.95
crit 1.57 17.69% 3587.98 3172 3870 2695.73 0 3870 5622 8037 22.56
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3906 / 521
Toxic Bile 3906 3.0% 54.5 1.94sec 2826 3031 Direct 54.5 2401 4802 2826 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.49 54.49 0.00 0.00 0.9324 0.0000 153987.15 153987.15 0.00 3030.94 3030.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.84 82.29% 2400.66 2116 2582 2402.26 2116 2571 107644 107644 0.00
crit 9.65 17.71% 4802.41 4233 5163 4774.63 0 5163 46343 46343 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - prince_malchezaar 4676 / 398
melee 3115 1.5% 21.2 1.47sec 3695 3139 Direct 21.2 3150 6284 3694 17.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.21 21.21 0.00 0.00 1.1771 0.0000 78353.48 112015.71 30.05 3138.66 3138.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.52 82.62% 3150.29 2784 3396 3156.77 2784 3383 55196 78910 30.05
crit 3.69 17.38% 6283.57 5567 6791 5998.15 0 6791 23157 33106 28.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1561 0.8% 21.2 1.47sec 1854 1489 Direct 21.2 1574 3148 1854 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.21 21.21 0.00 0.00 1.2449 0.0000 39316.87 56208.18 30.05 1489.28 1489.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.44 82.24% 1574.46 1392 1698 1577.69 1392 1690 27458 39255 30.05
crit 3.77 17.76% 3148.28 2784 3396 3046.80 0 3396 11859 16954 29.01
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 990 / 81
Eye of Gul'dan 990 0.5% 27.5 5.27sec 873 1148 Periodic 59.9 400 0 400 0.0% 58.7%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.48 0.00 59.94 59.94 0.7607 2.9368 23994.85 23994.85 0.00 121.84 1147.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.9 100.00% 400.31 181 461 399.38 381 405 23995 23995 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_GF_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.39sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2017 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Felguard
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.72sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1282 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2384 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.57sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5116 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 15.1 14.63sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.24sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.77 0.00 0.00 0.00 1.5399 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.12sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.26% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.4 23.2sec 10.2sec 51.81% 83.70% 15.4(15.4) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.81%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.1 12.4sec 5.3sec 38.68% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.82%
  • demonic_core_2:15.68%
  • demonic_core_3:5.01%
  • demonic_core_4:2.16%

Trigger Attempt Success

  • trigger_pct:25.76%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.07% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.62%
  • dreadstalkers_4:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.4 182.1sec 2.2sec 1.13% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.14%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.76% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.6sec 171.6sec 14.86% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.26% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 66.9sec 36.5sec 44.12% 0.00% 3.0(40.9) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.16%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.61% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.02%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.95%
  • portal_summons_5:1.39%
  • portal_summons_6:1.74%
  • portal_summons_7:4.32%
  • portal_summons_8:6.14%
  • portal_summons_9:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 181.0sec 113.0sec 1.19% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.2sec 10.3sec 67.52% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.60%
  • quick_navigation_2:17.22%
  • quick_navigation_3:16.62%
  • quick_navigation_4:16.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.2sec 52.2sec 17.53% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.08% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.69% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.69%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.34% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.34%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.8 55.2sec 0.0sec 96.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.31%
  • wild_imps_2:2.74%
  • wild_imps_3:28.83%
  • wild_imps_4:7.65%
  • wild_imps_5:9.45%
  • wild_imps_6:26.02%
  • wild_imps_7:5.85%
  • wild_imps_8:3.96%
  • wild_imps_9:4.79%
  • wild_imps_10:1.54%
  • wild_imps_11:1.15%
  • wild_imps_12:1.13%
  • wild_imps_13:0.44%
  • wild_imps_14:0.17%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Felguard_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_GF_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.8 21.7sec
two_shard_hog 3.8 16.4sec
three_shard_hog 47.8 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_GF_Felguard
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.2 90414.6 2000.0 2045.2 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.8 2.6 2.6 1974.3
shadow_bolt Mana 95.7 191434.7 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7204.1 2000.0 2000.1 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
felstorm Energy 10.4 624.8 60.0 60.0 181.4
legion_strike Energy 58.4 3505.1 60.0 60.0 90.7
pet - grimoire_felguard
felstorm Energy 3.9 236.6 60.0 60.0 177.4
legion_strike Energy 18.5 1107.3 60.0 60.0 107.4
pet - wild_imp
fel_firebolt Energy 996.2 15600.5 15.7 15.7 47.7
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.21 90.40 (48.57%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.72 95.72 (51.43%) 1.00 0.00 0.00%
mana_regen Mana 554.82 286343.71 (100.00%) 516.10 13097.13 4.37%
pet - felguard
energy_regen Energy 375.37 3989.63 (100.00%) 10.63 18.58 0.46%
pet - grimoire_felguard
energy_regen Energy 91.69 914.50 (100.00%) 9.97 48.40 5.03%
pet - demonic_tyrant
energy_regen Energy 37.77 0.00 (0.00%) 0.00 762.47 100.00%
pet - bilescourge
energy_regen Energy 14.10 0.00 (0.00%) 0.00 196.64 100.00%
pet - bilescourge
energy_regen Energy 10.93 0.00 (0.00%) 0.00 152.44 100.00%
pet - bilescourge
energy_regen Energy 12.12 0.00 (0.00%) 0.00 169.13 100.00%
pet - bilescourge
energy_regen Energy 11.24 0.00 (0.00%) 0.00 157.37 100.00%
pet - bilescourge
energy_regen Energy 1.24 0.00 (0.00%) 0.00 17.22 100.00%
pet - bilescourge
energy_regen Energy 0.01 0.00 (0.00%) 0.00 0.11 100.00%
pet - bilescourge
energy_regen Energy 0.57 0.00 (0.00%) 0.00 7.94 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.52 963.56
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97295.98 93144.00 100000.00
Soul Shard 2.56 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.6%

Statistics & Data Analysis

Fight Length
Sample Data DL_GF_Felguard Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_GF_Felguard Damage Per Second
Count 4999
Mean 17285.17
Minimum 15621.37
Maximum 19411.96
Spread ( max - min ) 3790.58
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 568.1055
5th Percentile 16413.53
95th Percentile 18283.88
( 95th Percentile - 5th Percentile ) 1870.35
Mean Distribution
Standard Deviation 8.0350
95.00% Confidence Intervall ( 17269.43 - 17300.92 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4150
0.1 Scale Factor Error with Delta=300 2756
0.05 Scale Factor Error with Delta=300 11021
0.01 Scale Factor Error with Delta=300 275513
Priority Target DPS
Sample Data DL_GF_Felguard Priority Target Damage Per Second
Count 4999
Mean 17285.17
Minimum 15621.37
Maximum 19411.96
Spread ( max - min ) 3790.58
Range [ ( max - min ) / 2 * 100% ] 10.96%
Standard Deviation 568.1055
5th Percentile 16413.53
95th Percentile 18283.88
( 95th Percentile - 5th Percentile ) 1870.35
Mean Distribution
Standard Deviation 8.0350
95.00% Confidence Intervall ( 17269.43 - 17300.92 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4150
0.1 Scale Factor Error with Delta=300 2756
0.05 Scale Factor Error with Delta=300 11021
0.01 Scale Factor Error with Delta=300 275513
DPS(e)
Sample Data DL_GF_Felguard Damage Per Second (Effective)
Count 4999
Mean 17285.17
Minimum 15621.37
Maximum 19411.96
Spread ( max - min ) 3790.58
Range [ ( max - min ) / 2 * 100% ] 10.96%
Damage
Sample Data DL_GF_Felguard Damage
Count 4999
Mean 1241688.53
Minimum 911159.92
Maximum 1667757.84
Spread ( max - min ) 756597.92
Range [ ( max - min ) / 2 * 100% ] 30.47%
DTPS
Sample Data DL_GF_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_GF_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_GF_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_GF_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_GF_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_GF_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_GF_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_GF_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.80 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.48 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.41 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.23 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.69 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.94 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.79 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.94 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKKKKKHFIHIIHKKHIIHKIHIHKKKIFKHEKKHKKIHIHIKKFHKKKHKKKHKKKFIHIIKHKEG8KHKKKKFHKKKHIIHIDIHIKKFHKKKHKKKEIHIIHFIHKKKHKKKKKaKKYZKKKKKXSSVSVST9AVPQVSVSKKKHKKIHIIHKFKHKIHKKKHIIKHFIKKEDHKKIHIKKFHKKHKKKHIKHKIIFHKKHKGKKEKHKKFKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_active O grimoire_felguard Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.258 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.567 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:04.869 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.846 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.147 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.147 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.147 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.241 nether_portal_active S hand_of_guldan Fluffy_Pillow 97099.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.064 build_a_shard K shadow_bolt Fluffy_Pillow 97922.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.159 nether_portal_active S hand_of_guldan Fluffy_Pillow 97017.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.982 build_a_shard K shadow_bolt Fluffy_Pillow 97840.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.068 nether_portal_active S hand_of_guldan Fluffy_Pillow 96926.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.859 build_a_shard K shadow_bolt Fluffy_Pillow 97717.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.912 nether_portal_active S hand_of_guldan Fluffy_Pillow 96770.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.704 build_a_shard K shadow_bolt Fluffy_Pillow 97562.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.752 nether_portal_active S hand_of_guldan Fluffy_Pillow 96610.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.515 build_a_shard K shadow_bolt Fluffy_Pillow 97373.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.532 nether_portal_active S hand_of_guldan Fluffy_Pillow 96390.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(3), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.410 build_a_shard K shadow_bolt Fluffy_Pillow 97268.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.569 build_a_shard K shadow_bolt Fluffy_Pillow 96427.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.696 build_a_shard K shadow_bolt Fluffy_Pillow 95554.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.822 build_a_shard K shadow_bolt Fluffy_Pillow 94680.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.950 build_a_shard K shadow_bolt Fluffy_Pillow 93808.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, prince_malchezaar, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:24.075 default H hand_of_guldan Fluffy_Pillow 92933.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.898 default F call_dreadstalkers Fluffy_Pillow 93756.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.718 default I demonbolt Fluffy_Pillow 94576.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.541 default H hand_of_guldan Fluffy_Pillow 93399.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.363 default I demonbolt Fluffy_Pillow 94221.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation_final, archive_of_the_titans(6)
0:28.277 default I demonbolt Fluffy_Pillow 93135.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation_final, archive_of_the_titans(6)
0:29.192 default H hand_of_guldan Fluffy_Pillow 92050.0/100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation_final, archive_of_the_titans(6)
0:30.107 build_a_shard K shadow_bolt Fluffy_Pillow 92965.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(7)
0:31.326 build_a_shard K shadow_bolt Fluffy_Pillow 92184.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:32.542 default H hand_of_guldan Fluffy_Pillow 91400.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(7)
0:33.457 default I demonbolt Fluffy_Pillow 92315.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(7)
0:34.257 default I demonbolt Fluffy_Pillow 91115.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(7)
0:35.060 default H hand_of_guldan Fluffy_Pillow 89918.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(8)
0:35.869 build_a_shard K shadow_bolt Fluffy_Pillow 90727.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(8)
0:36.945 default I demonbolt Fluffy_Pillow 89803.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(5), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(8)
0:37.753 default H hand_of_guldan Fluffy_Pillow 88611.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, wild_imps(6), overwhelming_power(21), archive_of_the_titans(8)
0:38.623 default I demonbolt Fluffy_Pillow 89481.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, wild_imps(6), quick_navigation, overwhelming_power(20), archive_of_the_titans(8)
0:39.493 default H hand_of_guldan Fluffy_Pillow 88351.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(19), archive_of_the_titans(8)
0:40.369 build_a_shard K shadow_bolt Fluffy_Pillow 89227.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(9)
0:41.534 build_a_shard K shadow_bolt Fluffy_Pillow 88392.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(9)
0:42.991 build_a_shard K shadow_bolt Fluffy_Pillow 87849.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(9), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(9)
0:44.454 default I demonbolt Fluffy_Pillow 87312.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(9)
0:45.564 default F call_dreadstalkers Fluffy_Pillow 86422.0/100000: 86% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(10)
0:46.681 build_a_shard K shadow_bolt Fluffy_Pillow 87539.0/100000: 88% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(10)
0:48.176 default H hand_of_guldan Fluffy_Pillow 87034.0/100000: 87% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(10)
0:49.269 default E summon_vilefiend Fluffy_Pillow 88127.0/100000: 88% mana | 2.0/5: 40% soul_shard wild_imps, dreadstalkers(2), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(10)
0:50.732 build_a_shard K shadow_bolt Fluffy_Pillow 89590.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(23), archive_of_the_titans(11)
0:52.203 build_a_shard K shadow_bolt Fluffy_Pillow 89061.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(11)
0:53.690 default H hand_of_guldan Fluffy_Pillow 88548.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(20), archive_of_the_titans(11)
0:54.806 build_a_shard K shadow_bolt Fluffy_Pillow 89664.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(19), archive_of_the_titans(11)
0:56.303 build_a_shard K shadow_bolt Fluffy_Pillow 89161.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(17), archive_of_the_titans(12)
0:57.808 default I demonbolt Fluffy_Pillow 88666.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(16), archive_of_the_titans(12)
0:58.945 default H hand_of_guldan Fluffy_Pillow 87803.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(12)
1:00.088 default I demonbolt Fluffy_Pillow 88946.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(13)
1:01.191 default H hand_of_guldan Fluffy_Pillow 88049.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(13)
1:02.301 default I demonbolt Fluffy_Pillow 89159.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(13)
1:03.415 build_a_shard K shadow_bolt Fluffy_Pillow 88273.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(13)
1:04.909 build_a_shard K shadow_bolt Fluffy_Pillow 87767.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(13)
1:06.412 default F call_dreadstalkers Fluffy_Pillow 87270.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(14)
1:07.553 default H hand_of_guldan Fluffy_Pillow 88411.0/100000: 88% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(14)
1:08.702 build_a_shard K shadow_bolt Fluffy_Pillow 89560.0/100000: 90% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(14)
1:10.238 build_a_shard K shadow_bolt Fluffy_Pillow 89096.0/100000: 89% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), overwhelming_power(3), archive_of_the_titans(15)
1:11.906 build_a_shard K shadow_bolt Fluffy_Pillow 88764.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), overwhelming_power(2), archive_of_the_titans(15)
1:13.585 default H hand_of_guldan Fluffy_Pillow 88443.0/100000: 88% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(15)
1:14.862 build_a_shard K shadow_bolt Fluffy_Pillow 89720.0/100000: 90% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(15)
1:16.563 build_a_shard K shadow_bolt Fluffy_Pillow 89421.0/100000: 89% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(16)
1:18.265 build_a_shard K shadow_bolt Fluffy_Pillow 89123.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(16)
1:19.956 default H hand_of_guldan Fluffy_Pillow 88814.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), quick_navigation, archive_of_the_titans(16)
1:21.223 build_a_shard K shadow_bolt Fluffy_Pillow 90081.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), quick_navigation, archive_of_the_titans(17)
1:22.911 build_a_shard K shadow_bolt Fluffy_Pillow 89769.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), quick_navigation, archive_of_the_titans(17)
1:24.601 build_a_shard K shadow_bolt Fluffy_Pillow 89459.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), quick_navigation, archive_of_the_titans(17)
1:26.291 default F call_dreadstalkers Fluffy_Pillow 89149.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), quick_navigation(2), archive_of_the_titans(18)
1:28.091 default I demonbolt Fluffy_Pillow 90949.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(18)
1:29.352 default H hand_of_guldan Fluffy_Pillow 90210.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(18)
1:30.612 default I demonbolt Fluffy_Pillow 91470.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(19)
1:31.705 default I demonbolt Fluffy_Pillow 90563.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps, dreadstalkers(2), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(19)
1:32.801 build_a_shard K shadow_bolt Fluffy_Pillow 89659.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(19)
1:34.271 default H hand_of_guldan Fluffy_Pillow 89129.0/100000: 89% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(19)
1:35.387 build_a_shard K shadow_bolt Fluffy_Pillow 90245.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
1:36.881 default E summon_vilefiend Fluffy_Pillow 89739.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
1:38.385 default G summon_demonic_tyrant Fluffy_Pillow 91243.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
1:39.907 default 8 potion Fluffy_Pillow 90765.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
1:39.907 build_a_shard K shadow_bolt Fluffy_Pillow 90765.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
1:41.436 default H hand_of_guldan Fluffy_Pillow 90294.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
1:42.598 build_a_shard K shadow_bolt Fluffy_Pillow 91456.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
1:44.152 build_a_shard K shadow_bolt Fluffy_Pillow 91010.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
1:45.718 build_a_shard K shadow_bolt Fluffy_Pillow 90576.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
1:47.293 build_a_shard K shadow_bolt Fluffy_Pillow 90151.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
1:48.886 default F call_dreadstalkers Fluffy_Pillow 89744.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
1:50.087 default H hand_of_guldan Fluffy_Pillow 90945.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20), battle_potion_of_intellect
1:51.303 build_a_shard K shadow_bolt Fluffy_Pillow 92161.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20), battle_potion_of_intellect
1:52.922 build_a_shard K shadow_bolt Fluffy_Pillow 91780.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20), battle_potion_of_intellect
1:54.552 build_a_shard K shadow_bolt Fluffy_Pillow 91410.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power, archive_of_the_titans(20), battle_potion_of_intellect
1:56.201 default H hand_of_guldan Fluffy_Pillow 91059.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:57.445 default I demonbolt Fluffy_Pillow 92303.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:58.634 default I demonbolt Fluffy_Pillow 91492.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:59.822 default H hand_of_guldan Fluffy_Pillow 90680.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:01.009 default I demonbolt Fluffy_Pillow 91867.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(3), supreme_commander, wild_imps(9), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:02.197 default D grimoire_felguard Fluffy_Pillow 91055.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:03.385 default I demonbolt Fluffy_Pillow 92243.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:04.570 default H hand_of_guldan Fluffy_Pillow 91428.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
2:05.760 default I demonbolt Fluffy_Pillow 92618.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:06.946 build_a_shard K shadow_bolt Fluffy_Pillow 91804.0/100000: 92% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:08.530 build_a_shard K shadow_bolt Fluffy_Pillow 91388.0/100000: 91% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(6), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:10.220 default F call_dreadstalkers Fluffy_Pillow 91078.0/100000: 91% mana | 5.0/5: 100% soul_shard wild_imps(5), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:11.911 default H hand_of_guldan Fluffy_Pillow 92769.0/100000: 93% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:13.179 build_a_shard K shadow_bolt Fluffy_Pillow 94037.0/100000: 94% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:14.869 build_a_shard K shadow_bolt Fluffy_Pillow 93727.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:16.559 build_a_shard K shadow_bolt Fluffy_Pillow 93417.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation(2), archive_of_the_titans(20)
2:18.241 default H hand_of_guldan Fluffy_Pillow 93099.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:19.501 build_a_shard K shadow_bolt Fluffy_Pillow 94359.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:21.180 build_a_shard K shadow_bolt Fluffy_Pillow 94038.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:22.851 build_a_shard K shadow_bolt Fluffy_Pillow 93709.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:24.512 default E summon_vilefiend Fluffy_Pillow 93370.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:26.172 default I demonbolt Fluffy_Pillow 95030.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:27.415 default H hand_of_guldan Fluffy_Pillow 94273.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:28.659 default I demonbolt Fluffy_Pillow 95517.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:29.741 default I demonbolt Fluffy_Pillow 94599.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps, vilefiend, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
2:30.828 default H hand_of_guldan Fluffy_Pillow 93686.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
2:31.920 default F call_dreadstalkers Fluffy_Pillow 94778.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:32.975 default I demonbolt Fluffy_Pillow 95833.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:34.034 default H hand_of_guldan Fluffy_Pillow 94892.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:35.105 build_a_shard K shadow_bolt Fluffy_Pillow 95963.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:36.539 build_a_shard K shadow_bolt Fluffy_Pillow 95397.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
2:37.978 build_a_shard K shadow_bolt Fluffy_Pillow 94836.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
2:39.362 default H hand_of_guldan Fluffy_Pillow 94220.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
2:40.410 build_a_shard K shadow_bolt Fluffy_Pillow 95268.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:41.813 build_a_shard K shadow_bolt Fluffy_Pillow 94671.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:43.224 build_a_shard K shadow_bolt Fluffy_Pillow 94082.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(19), archive_of_the_titans(20)
2:44.744 build_a_shard K shadow_bolt Fluffy_Pillow 93602.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), overwhelming_power(18), archive_of_the_titans(20)
2:46.277 build_a_shard K shadow_bolt Fluffy_Pillow 93135.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), overwhelming_power(16), archive_of_the_titans(20)
2:47.824 nether_portal_building a hand_of_guldan Fluffy_Pillow 92682.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), overwhelming_power(15), archive_of_the_titans(20)
2:48.992 build_a_shard K shadow_bolt Fluffy_Pillow 93850.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(2), overwhelming_power(14), archive_of_the_titans(20)
2:50.555 build_a_shard K shadow_bolt Fluffy_Pillow 93413.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(4), demonic_calling, wild_imps(2), overwhelming_power(12), archive_of_the_titans(20)
2:52.137 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 92995.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(10), archive_of_the_titans(20)
2:53.330 nether_portal_building Z hand_of_guldan Fluffy_Pillow 94188.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(9), archive_of_the_titans(20)
2:54.532 build_a_shard K shadow_bolt Fluffy_Pillow 95390.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(4), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
2:56.143 build_a_shard K shadow_bolt Fluffy_Pillow 95001.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(4), demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
2:57.772 build_a_shard K shadow_bolt Fluffy_Pillow 94630.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
2:59.410 build_a_shard K shadow_bolt Fluffy_Pillow 94268.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(4), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
3:01.069 build_a_shard K shadow_bolt Fluffy_Pillow 93927.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(20)
3:02.748 nether_portal_building X nether_portal Fluffy_Pillow 93606.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:04.008 nether_portal_active S hand_of_guldan Fluffy_Pillow 94866.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), portal_summons, quick_navigation(2), archive_of_the_titans(20)
3:05.269 nether_portal_active S hand_of_guldan Fluffy_Pillow 96127.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, portal_summons(2), quick_navigation(3), archive_of_the_titans(20)
3:06.520 nether_portal_active V demonbolt Fluffy_Pillow 97378.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps, portal_summons(3), quick_navigation(3), archive_of_the_titans(20)
3:07.774 nether_portal_active S hand_of_guldan Fluffy_Pillow 96632.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(3), archive_of_the_titans(20)
3:09.027 nether_portal_active V demonbolt Fluffy_Pillow 97885.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:10.280 nether_portal_active S hand_of_guldan Fluffy_Pillow 97138.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(6), portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:11.532 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 98390.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(7), portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:13.202 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:13.202 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:13.202 nether_portal_active V demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:14.257 nether_portal_active P summon_vilefiend Fluffy_Pillow 97060.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(9), tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:15.660 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98463.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(8), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:16.715 nether_portal_active V demonbolt Fluffy_Pillow 99518.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:17.769 nether_portal_active S hand_of_guldan Fluffy_Pillow 98572.0/100000: 99% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.785 nether_portal_active V demonbolt Fluffy_Pillow 99588.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.758 nether_portal_active S hand_of_guldan Fluffy_Pillow 98561.0/100000: 99% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.729 build_a_shard K shadow_bolt Fluffy_Pillow 99532.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.024 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.281 build_a_shard K shadow_bolt Fluffy_Pillow 97263.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.725 default H hand_of_guldan Fluffy_Pillow 96707.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.810 build_a_shard K shadow_bolt Fluffy_Pillow 97792.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.213 build_a_shard K shadow_bolt Fluffy_Pillow 97195.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(13), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.617 default I demonbolt Fluffy_Pillow 96599.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(15), vilefiend, portal_summons(7), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.670 default H hand_of_guldan Fluffy_Pillow 95652.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(15), vilefiend, portal_summons(7), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.760 default I demonbolt Fluffy_Pillow 96742.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(13), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.849 default I demonbolt Fluffy_Pillow 95831.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(12), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.939 default H hand_of_guldan Fluffy_Pillow 94921.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(13), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.028 build_a_shard K shadow_bolt Fluffy_Pillow 96010.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(10), archive_of_the_titans(20)
3:35.728 default F call_dreadstalkers Fluffy_Pillow 95710.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(5), archive_of_the_titans(20)
3:37.007 build_a_shard K shadow_bolt Fluffy_Pillow 96989.0/100000: 97% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:38.706 default H hand_of_guldan Fluffy_Pillow 96688.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:39.982 build_a_shard K shadow_bolt Fluffy_Pillow 97964.0/100000: 98% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:41.683 default I demonbolt Fluffy_Pillow 97665.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
3:42.959 default H hand_of_guldan Fluffy_Pillow 96941.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:44.238 build_a_shard K shadow_bolt Fluffy_Pillow 98220.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:45.927 build_a_shard K shadow_bolt Fluffy_Pillow 97909.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:47.616 build_a_shard K shadow_bolt Fluffy_Pillow 97598.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:49.304 default H hand_of_guldan Fluffy_Pillow 97286.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:50.573 default I demonbolt Fluffy_Pillow 98555.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
3:51.842 default I demonbolt Fluffy_Pillow 97824.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
3:53.110 build_a_shard K shadow_bolt Fluffy_Pillow 97092.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:54.799 default H hand_of_guldan Fluffy_Pillow 96781.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
3:56.060 default F call_dreadstalkers Fluffy_Pillow 98042.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
3:57.321 default I demonbolt Fluffy_Pillow 99303.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:58.582 build_a_shard K shadow_bolt Fluffy_Pillow 98564.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:00.253 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:01.923 default E summon_vilefiend Fluffy_Pillow 97676.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:03.593 default D grimoire_felguard Fluffy_Pillow 99346.0/100000: 99% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:04.847 default H hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:06.099 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps, dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:07.769 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:09.436 default I demonbolt Fluffy_Pillow 97672.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:10.680 default H hand_of_guldan Fluffy_Pillow 96916.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:11.927 default I demonbolt Fluffy_Pillow 98163.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:13.113 build_a_shard K shadow_bolt Fluffy_Pillow 97349.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:14.697 build_a_shard K shadow_bolt Fluffy_Pillow 96933.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:16.280 default F call_dreadstalkers Fluffy_Pillow 96516.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:17.467 default H hand_of_guldan Fluffy_Pillow 97703.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:18.655 build_a_shard K shadow_bolt Fluffy_Pillow 98891.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:20.238 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:21.820 default H hand_of_guldan Fluffy_Pillow 97587.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:23.005 build_a_shard K shadow_bolt Fluffy_Pillow 98772.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), overwhelming_power(25), archive_of_the_titans(20)
4:24.477 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), overwhelming_power(24), archive_of_the_titans(20)
4:25.955 build_a_shard K shadow_bolt Fluffy_Pillow 97483.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), overwhelming_power(23), archive_of_the_titans(20)
4:27.441 default H hand_of_guldan Fluffy_Pillow 96969.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
4:28.566 default I demonbolt Fluffy_Pillow 98094.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
4:29.694 build_a_shard K shadow_bolt Fluffy_Pillow 97222.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
4:31.207 default H hand_of_guldan Fluffy_Pillow 96735.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
4:32.357 build_a_shard K shadow_bolt Fluffy_Pillow 97885.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:33.823 default I demonbolt Fluffy_Pillow 97351.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
4:34.926 default I demonbolt Fluffy_Pillow 96454.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:36.037 default F call_dreadstalkers Fluffy_Pillow 95565.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
4:37.404 default H hand_of_guldan Fluffy_Pillow 96932.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
4:38.526 build_a_shard K shadow_bolt Fluffy_Pillow 98054.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
4:40.029 build_a_shard K shadow_bolt Fluffy_Pillow 97557.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
4:41.542 default H hand_of_guldan Fluffy_Pillow 97070.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
4:42.683 build_a_shard K shadow_bolt Fluffy_Pillow 98211.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
4:44.213 default G summon_demonic_tyrant Fluffy_Pillow 97741.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
4:45.760 build_a_shard K shadow_bolt Fluffy_Pillow 97288.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation(3), overwhelming_power(12), archive_of_the_titans(20)
4:47.315 build_a_shard K shadow_bolt Fluffy_Pillow 96843.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), tyrant, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
4:48.888 default E summon_vilefiend Fluffy_Pillow 96416.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), tyrant, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20)
4:50.461 build_a_shard K shadow_bolt Fluffy_Pillow 97989.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20)
4:52.052 default H hand_of_guldan Fluffy_Pillow 97580.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(5), archive_of_the_titans(20)
4:53.259 build_a_shard K shadow_bolt Fluffy_Pillow 98787.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
4:54.806 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
4:56.361 default F call_dreadstalkers Fluffy_Pillow 97560.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
4:57.542 build_a_shard K shadow_bolt Fluffy_Pillow 98741.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:59.123 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_GF_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DL_GF_Imp : 17277 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17276.9 17276.9 16.2 / 0.094% 2275.9 / 13.2% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.4 954.4 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_GF_Imp 17277
Demonbolt 1256 7.3% 44.1 6.21sec 8541 7505 Direct 45.0 7110 14227 8382 17.9%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.12 44.96 0.00 0.00 1.1381 0.0000 376864.79 376864.79 0.00 7504.73 7504.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.92 82.12% 7109.60 6520 8308 7110.78 6927 7308 262516 262516 0.00
crit 8.04 17.88% 14226.67 13040 16616 14217.50 0 16099 114349 114349 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1051 6.1% 60.4 4.89sec 5220 4737 Direct 60.3 4448 8897 5232 17.6%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.42 60.28 0.00 0.00 1.1020 0.0000 315390.72 315390.72 0.00 4736.66 4736.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.67 82.40% 4448.49 1634 5979 4442.39 3988 4874 220962 220962 0.00
crit 10.61 17.60% 8897.37 3267 11958 8885.12 5203 10730 94429 94429 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 142 (203) 0.8% (1.2%) 7.4 35.90sec 8282 0 Direct 7.4 4925 9849 5800 17.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.36 7.36 0.00 0.00 0.0000 0.0000 42696.14 42696.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.05 82.23% 4924.62 4925 4925 4918.71 0 4925 29811 29811 0.00
crit 1.31 17.77% 9849.24 9849 9849 7283.99 0 9849 12885 12885 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.4% 7.4 35.90sec 2482 0 Direct 7.4 2111 4221 2482 17.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.36 7.36 0.00 0.00 0.0000 0.0000 18273.86 18273.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.07 82.39% 2110.55 2111 2111 2109.71 0 2111 12801 12801 0.00
crit 1.30 17.61% 4221.10 4221 4221 3150.42 0 4221 5473 5473 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1342 7.8% 95.8 3.06sec 4200 2812 Direct 95.1 3595 7189 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.78 95.11 0.00 0.00 1.4937 0.0000 402281.00 402281.00 0.00 2811.88 2811.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.31 82.34% 3594.60 3373 4297 3595.16 3553 3646 281502 281502 0.00
crit 16.80 17.66% 7188.84 6745 8595 7189.63 6910 7587 120779 120779 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 287 1.7% 7.3 36.27sec 11893 0 Direct 7.2 10240 20481 12048 17.6%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.25 7.16 0.00 0.00 0.0000 0.0000 86235.61 86235.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.89 82.35% 10240.44 10240 10240 10236.34 0 10240 60367 60367 0.00
crit 1.26 17.65% 20480.88 20481 20481 14884.38 0 20481 25868 25868 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3146 / 3146
Firebolt 3146 18.2% 103.9 2.89sec 9074 6944 Direct 103.0 7776 15545 9147 17.6%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.86 103.04 0.00 0.00 1.3067 0.0000 942462.23 942462.23 0.00 6944.06 6944.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.86 82.35% 7775.69 7027 9401 7776.86 7626 7927 659826 659826 0.00
crit 18.18 17.65% 15544.88 14053 18802 15546.56 14556 17043 282636 282636 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - grimoire_felguard 4766 / 1032
Felstorm 652 0.8% 3.9 80.92sec 10652 3639 Periodic 19.5 1829 3658 2155 17.8% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.47 19.47 2.9275 0.5923 41965.19 59994.29 30.05 3638.71 3638.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.19% 1829.48 1715 2197 1830.14 1776 2084 29278 41856 30.05
crit 3.5 17.81% 3657.95 3430 4393 3583.41 0 4393 12688 18138 29.44
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1850 2.3% 18.5 13.89sec 6452 6452 Direct 18.5 5478 10946 6452 17.8%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.46 18.46 0.00 0.00 1.0000 0.0000 119069.59 170224.28 30.05 6451.89 6451.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.17 82.19% 5478.16 5020 6430 5480.69 5227 6026 83102 118804 30.05
crit 3.29 17.81% 10945.56 10040 12861 10641.53 0 12554 35968 51420 29.22
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2263 2.8% 41.0 6.36sec 3554 3005 Direct 41.0 3020 6039 3554 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.96 40.96 0.00 0.00 1.1826 0.0000 145580.47 208124.76 30.05 3005.25 3005.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.72 82.32% 3020.42 2744 3515 3021.27 2934 3205 101848 145603 30.05
crit 7.24 17.68% 6039.07 5488 7030 6036.30 0 6728 43733 62521 30.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - darkhound 1310 / 176
Fel Bite 470 0.4% 8.9 13.10sec 2116 2116 Direct 8.9 1796 3588 2116 17.8%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.91 8.91 0.00 0.00 1.0000 0.0000 18856.06 26957.00 30.05 2116.04 2116.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.32 82.15% 1796.18 1586 1935 1796.78 0 1935 13150 18799 29.99
crit 1.59 17.85% 3588.10 3172 3870 2690.51 0 3870 5706 8158 22.53
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 840 0.6% 42.7 2.65sec 782 666 Direct 42.7 665 1330 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.66 42.66 0.00 0.00 1.1749 0.0000 33378.93 47719.19 30.05 665.93 665.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.13 82.35% 665.03 587 717 665.64 587 714 23363 33400 30.05
crit 7.53 17.65% 1330.00 1175 1433 1310.48 0 1433 10016 14319 29.56
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - void_terror 1815 / 242
Double Breath 0 (131) 0.0% (0.8%) 0.0 0.00sec 0 7411

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7410.87 7410.87
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 491 0.4% 6.9 16.82sec 2811 0 Direct 6.9 2388 4779 2811 17.7%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.0000 0.0000 19439.43 19439.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.32% 2388.06 2116 2582 2381.76 0 2582 13596 13596 0.00
crit 1.22 17.68% 4778.78 4233 5163 3203.47 0 5163 5844 5844 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 492 0.4% 6.9 16.82sec 2812 0 Direct 6.9 2389 4771 2812 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.0000 0.0000 19445.39 19445.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.25% 2388.87 2116 2582 2380.97 0 2582 13590 13590 0.00
crit 1.23 17.75% 4771.21 4233 5163 3206.78 0 5163 5856 5856 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 832 0.6% 41.9 2.60sec 782 664 Direct 41.9 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.89 41.89 0.00 0.00 1.1781 0.0000 32758.15 46831.71 30.05 663.77 663.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.50 82.35% 664.77 587 717 665.54 587 714 22933 32786 30.05
crit 7.39 17.65% 1328.83 1175 1433 1306.76 0 1433 9825 14046 29.52
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3206 / 1516
Bile Spit 1167 3.2% 6.8 47.23sec 24263 0 Direct 6.8 8929 17863 10482 17.4%  
Periodic 33.2 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 6.77 33.16 33.16 0.0000 2.0000 164567.66 164567.66 0.00 2481.12 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.59 82.62% 8928.78 8474 11254 8926.40 0 9649 49949 49949 0.00
crit 1.18 17.38% 17862.88 16947 20207 12755.58 0 20207 21026 21026 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2822.15 2502 3310 2822.76 2633 2885 93593 93593 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.0% 28.5 10.26sec 3652 3652 Direct 28.5 3106 6212 3652 17.6%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.51 28.51 0.00 0.00 1.0000 0.0000 104117.85 148848.97 30.05 3652.10 3652.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.49 82.41% 3105.67 2737 3621 3107.01 2968 3269 72967 104315 30.05
crit 5.02 17.59% 6211.63 5474 7243 6185.41 0 7243 31151 44534 29.91
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.6% 102.8 2.81sec 1800 1353 Direct 102.8 1531 3061 1800 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.82 102.82 0.00 0.00 1.3306 0.0000 185060.82 264566.66 30.05 1352.77 1352.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.72 82.40% 1530.61 1337 1775 1531.16 1468 1571 129678 185390 30.05
crit 18.09 17.60% 3061.19 2673 3550 3062.01 2822 3330 55383 79177 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3640 / 2406
Dreadbite 1334 5.1% 29.1 20.93sec 9079 0 Direct 29.1 7719 15425 9079 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.10 29.10 0.00 0.00 0.0000 0.0000 264165.41 264165.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.96 82.35% 7719.41 7139 9517 7719.70 7446 7964 184961 184961 0.00
crit 5.13 17.65% 15424.66 14278 19033 15333.77 0 19033 79205 79205 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2307 8.8% 312.3 1.89sec 1464 1106 Direct 312.3 1244 2488 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.25 312.25 0.00 0.00 1.3234 0.0000 457124.12 653513.83 30.05 1106.20 1106.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.97 82.30% 1243.66 1101 1473 1243.84 1229 1262 319584 456883 30.05
crit 55.28 17.70% 2487.94 2203 2947 2488.30 2368 2603 137541 196631 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - vicious_hellhound 1061 / 143
Demon Fangs 653 0.5% 9.3 12.58sec 2815 2815 Direct 9.3 2393 4784 2815 17.7%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.29 9.29 0.00 0.00 1.0000 0.0000 26142.21 26142.21 0.00 2815.23 2815.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.65 82.35% 2393.10 2116 2582 2396.05 0 2582 18301 18301 0.00
crit 1.64 17.65% 4784.09 4233 5163 3595.12 0 5163 7841 7841 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 407 0.3% 82.2 1.36sec 196 326 Direct 82.2 167 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.21 82.21 0.00 0.00 0.6019 0.0000 16114.16 23037.12 30.05 325.66 325.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.67 82.30% 166.52 147 179 166.70 147 178 11268 16109 30.05
crit 14.55 17.70% 333.13 294 358 333.00 0 358 4846 6928 30.01
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - wild_imp 2575 / 2475
Fel Firebolt 2575 14.4% 994.5 0.29sec 747 502 Direct 990.4 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 994.49 990.37 0.00 0.00 1.4874 0.0000 742494.20 742494.20 0.00 501.94 501.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 815.06 82.30% 636.94 569 761 636.96 625 649 519149 519149 0.00
crit 175.31 17.70% 1274.01 1138 1523 1274.05 1239 1311 223345 223345 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4660 / 823
Demonfire 4660 4.8% 37.7 6.92sec 6529 4889 Direct 37.7 5560 11125 6543 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.74 37.66 0.00 0.00 1.3355 0.0000 246427.13 246427.13 0.00 4888.55 4888.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.01 82.34% 5560.48 5312 5917 5563.80 5441 5670 172431 172431 0.00
crit 6.65 17.66% 11125.47 10624 11834 11121.87 0 11834 73996 73996 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - illidari_satyr 1269 / 172
melee 420 0.3% 42.8 2.77sec 392 333 Direct 42.8 332 665 392 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.76 42.76 0.00 0.00 1.1760 0.0000 16747.83 23943.04 30.05 333.05 333.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.14 82.17% 332.37 294 358 332.82 294 357 11678 16696 30.05
crit 7.62 17.83% 664.96 587 717 657.80 0 717 5069 7247 29.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 210 0.2% 42.8 2.77sec 196 157 Direct 42.8 166 332 196 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.76 42.76 0.00 0.00 1.2434 0.0000 8368.80 11964.21 30.05 157.40 157.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.17 82.24% 166.18 147 179 166.40 147 178 5844 8355 30.05
crit 7.59 17.76% 332.47 294 358 328.58 0 358 2524 3609 29.65
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 639 0.5% 9.1 13.43sec 2816 2816 Direct 9.1 2395 4791 2816 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.13 9.13 0.00 0.00 1.0000 0.0000 25696.96 25696.96 0.00 2815.80 2815.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.52 82.45% 2395.24 2116 2582 2396.61 0 2582 18023 18023 0.00
crit 1.60 17.55% 4790.84 4233 5163 3603.48 0 5163 7674 7674 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wrathguard 1725 / 231
melee 835 0.6% 42.2 2.65sec 782 665 Direct 42.2 665 1329 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.23 42.23 0.00 0.00 1.1771 0.0000 33032.44 47223.84 30.05 664.57 664.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.76 82.31% 664.66 587 717 665.67 587 714 23102 33027 30.05
crit 7.47 17.69% 1329.14 1175 1433 1305.78 0 1433 9930 14197 29.48
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 419 0.3% 42.2 2.65sec 392 315 Direct 42.2 332 665 392 18.0%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.23 42.23 0.00 0.00 1.2445 0.0000 16555.46 23668.02 30.05 315.01 315.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.64 82.04% 332.30 294 358 332.81 294 357 11512 16458 30.05
crit 7.59 17.96% 664.88 587 717 658.86 0 717 5044 7210 29.73
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 471 0.4% 8.8 13.08sec 2116 2117 Direct 8.8 1795 3588 2116 17.9%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 1.0000 0.0000 18729.52 26776.10 30.05 2116.57 2116.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.26 82.05% 1794.59 1586 1935 1794.90 0 1935 13032 18630 29.97
crit 1.59 17.95% 3587.56 3172 3870 2695.88 0 3870 5698 8146 22.55
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3966 / 529
Toxic Bile 3966 3.0% 55.4 1.93sec 2826 3037 Direct 55.4 2402 4801 2826 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.43 55.43 0.00 0.00 0.9304 0.0000 156646.45 156646.45 0.00 3037.37 3037.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.63 82.31% 2401.55 2116 2582 2403.55 2116 2570 109580 109580 0.00
crit 9.80 17.69% 4801.00 4233 5163 4775.34 0 5163 47067 47067 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - urzul 1349 / 180
Many Faced Bite 503 0.4% 9.4 12.12sec 2110 2111 Direct 9.4 1793 3592 2110 17.6%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.43 9.43 0.00 0.00 1.0000 0.0000 19893.86 28440.66 30.05 2110.53 2110.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.76 82.36% 1793.10 1586 1935 1793.42 0 1935 13922 19904 30.01
crit 1.66 17.64% 3591.73 3172 3870 2750.32 0 3870 5972 8537 22.98
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 846 0.6% 42.5 2.60sec 783 667 Direct 42.5 665 1330 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.48 42.48 0.00 0.00 1.1738 0.0000 33251.63 47537.20 30.05 666.89 666.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.96 82.31% 665.26 587 717 665.90 587 714 23261 33254 30.05
crit 7.51 17.69% 1329.55 1175 1433 1311.83 0 1433 9991 14283 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - shivarra 1941 / 262
melee 837 0.6% 42.7 2.63sec 782 664 Direct 42.7 665 1329 782 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.67 42.67 0.00 0.00 1.1780 0.0000 33358.67 47690.22 30.05 663.63 663.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.15 82.36% 664.62 587 717 665.38 587 714 23358 33394 30.05
crit 7.53 17.64% 1328.91 1175 1433 1312.95 0 1433 10000 14297 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 419 0.3% 42.7 2.63sec 391 314 Direct 42.7 332 664 391 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.67 42.67 0.00 0.00 1.2453 0.0000 16703.85 23880.15 30.05 314.36 314.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.07 82.19% 332.34 294 358 332.71 294 357 11655 16662 30.05
crit 7.60 17.81% 664.23 587 717 655.36 0 717 5049 7218 29.62
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (93) 0.0% (0.5%) 0.0 0.00sec 0 3973

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3973.18 3973.18
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 171 0.1% 6.9 17.56sec 993 0 Direct 6.9 844 1686 993 17.7%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6853.48 9797.87 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.34% 843.79 749 914 842.54 0 914 4798 6859 29.95
crit 1.22 17.66% 1686.33 1498 1827 1131.01 0 1827 2056 2939 20.14
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 171 0.1% 6.9 17.56sec 994 0 Direct 6.9 844 1687 994 17.8%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6862.86 9811.29 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 82.19% 843.68 749 914 841.46 0 914 4788 6845 29.91
crit 1.23 17.81% 1687.33 1498 1827 1139.65 0 1827 2075 2966 20.29
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 172 0.1% 6.9 17.56sec 996 0 Direct 6.9 844 1687 996 18.0%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6874.45 9827.85 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.66 81.99% 843.74 749 914 839.92 0 914 4777 6829 29.86
crit 1.24 18.01% 1686.77 1498 1827 1136.05 0 1827 2098 2999 20.23
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 171 0.1% 6.9 17.56sec 991 0 Direct 6.9 844 1688 991 17.4%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 6840.08 9778.71 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.70 82.59% 843.62 749 914 840.15 0 914 4811 6878 29.88
crit 1.20 17.41% 1687.93 1498 1827 1124.60 0 1827 2029 2901 20.00
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4653 / 397
melee 3099 1.5% 21.3 1.47sec 3700 3135 Direct 21.3 3150 6284 3700 17.5%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.33 21.33 0.00 0.00 1.1802 0.0000 78921.97 112828.43 30.05 3135.06 3135.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.59 82.45% 3149.98 2784 3396 3155.75 2784 3381 55398 79198 30.05
crit 3.74 17.55% 6284.17 5567 6791 6117.49 0 6791 23524 33631 29.18
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1554 0.8% 21.3 1.47sec 1855 1487 Direct 21.3 1575 3141 1855 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.33 21.33 0.00 0.00 1.2472 0.0000 39557.03 56551.52 30.05 1486.99 1486.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.52 82.16% 1575.12 1392 1698 1578.20 1392 1691 27603 39462 30.05
crit 3.81 17.84% 3141.03 2784 3396 3030.19 0 3396 11954 17090 28.93
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 1002 / 81
Eye of Gul'dan 1002 0.5% 27.5 4.44sec 876 1152 Periodic 60.2 400 0 400 0.0% 58.9%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.50 0.00 60.20 60.20 0.7606 2.9355 24090.30 24090.30 0.00 121.89 1151.60
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.2 100.00% 400.16 181 461 399.15 374 405 24090 24090 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_GF_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.21sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.93sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2007 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_GF_Imp
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.73sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1275 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2378 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.46sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5118 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 15.1 14.67sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.23sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 0.00 0.00 1.5397 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.19sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.43% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.4 23.1sec 10.2sec 51.91% 83.95% 15.4(15.4) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.91%

Trigger Attempt Success

  • trigger_pct:20.06%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 30.0 12.3sec 5.3sec 38.59% 100.00% 4.4(4.4) 0.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.84%
  • demonic_core_2:15.67%
  • demonic_core_3:5.02%
  • demonic_core_4:2.06%

Trigger Attempt Success

  • trigger_pct:25.71%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.68% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.09% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.65%
  • dreadstalkers_4:6.44%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 182.1sec 1.7sec 1.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.26%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.8sec 120.8sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.8sec 171.8sec 14.86% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.89%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.26% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 67.1sec 36.6sec 44.06% 0.00% 3.0(41.5) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.29%
  • overwhelming_power_2:1.32%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.43%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.29%
  • overwhelming_power_23:2.35%
  • overwhelming_power_24:2.41%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.61% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.01%
  • portal_summons_2:0.75%
  • portal_summons_3:1.26%
  • portal_summons_4:1.96%
  • portal_summons_5:1.37%
  • portal_summons_6:1.76%
  • portal_summons_7:4.33%
  • portal_summons_8:6.10%
  • portal_summons_9:0.06%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 182.2sec 121.7sec 1.24% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.44% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.63%
  • quick_navigation_2:17.07%
  • quick_navigation_3:16.52%
  • quick_navigation_4:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.47% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 79.9sec 17.08% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.68% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.43% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.43%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.7 55.6sec 0.0sec 96.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.30%
  • wild_imps_2:2.77%
  • wild_imps_3:28.84%
  • wild_imps_4:7.66%
  • wild_imps_5:9.50%
  • wild_imps_6:26.03%
  • wild_imps_7:5.86%
  • wild_imps_8:4.01%
  • wild_imps_9:4.77%
  • wild_imps_10:1.53%
  • wild_imps_11:1.13%
  • wild_imps_12:1.08%
  • wild_imps_13:0.41%
  • wild_imps_14:0.17%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
  • wild_imps_18:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.8sec 120.8sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_GF_Imp_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_GF_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.8 21.6sec
two_shard_hog 3.8 17.1sec
three_shard_hog 47.7 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_GF_Imp
call_dreadstalkers Soul Shard 14.6 16.9 1.2 1.2 0.0
demonbolt Mana 45.1 90244.3 2000.0 2045.3 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.8 2.6 2.6 1974.2
shadow_bolt Mana 95.8 191562.3 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7202.5 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.9 4154.5 40.0 40.0 226.9
pet - grimoire_felguard
felstorm Energy 3.9 236.4 60.0 60.0 177.5
legion_strike Energy 18.5 1107.4 60.0 60.0 107.5
pet - wild_imp
fel_firebolt Energy 994.5 15592.7 15.7 15.7 47.6
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.12 90.23 (48.51%) 2.00 0.01 0.01%
shadow_bolt Soul Shard 95.78 95.78 (51.49%) 1.00 0.00 0.00%
mana_regen Mana 554.49 286303.77 (100.00%) 516.34 13148.06 4.39%
pet - imp
energy_regen Energy 427.60 3983.65 (100.00%) 9.32 22.74 0.57%
pet - grimoire_felguard
energy_regen Energy 91.75 914.74 (100.00%) 9.97 48.43 5.03%
pet - demonic_tyrant
energy_regen Energy 37.75 0.00 (0.00%) 0.00 761.97 100.00%
pet - bilescourge
energy_regen Energy 11.79 0.00 (0.00%) 0.00 164.01 100.00%
pet - bilescourge
energy_regen Energy 12.15 0.00 (0.00%) 0.00 168.57 100.00%
pet - bilescourge
energy_regen Energy 7.85 0.00 (0.00%) 0.00 109.08 100.00%
pet - bilescourge
energy_regen Energy 9.90 0.00 (0.00%) 0.00 137.03 100.00%
pet - bilescourge
energy_regen Energy 8.60 0.00 (0.00%) 0.00 118.95 100.00%
pet - bilescourge
energy_regen Energy 1.85 0.00 (0.00%) 0.00 26.07 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.39 963.41
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97306.91 90190.00 100000.00
Soul Shard 2.54 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%

Statistics & Data Analysis

Fight Length
Sample Data DL_GF_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_GF_Imp Damage Per Second
Count 4999
Mean 17276.88
Minimum 15625.85
Maximum 19520.39
Spread ( max - min ) 3894.54
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 583.1848
5th Percentile 16393.45
95th Percentile 18312.89
( 95th Percentile - 5th Percentile ) 1919.44
Mean Distribution
Standard Deviation 8.2483
95.00% Confidence Intervall ( 17260.71 - 17293.04 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4378
0.1 Scale Factor Error with Delta=300 2904
0.05 Scale Factor Error with Delta=300 11614
0.01 Scale Factor Error with Delta=300 290333
Priority Target DPS
Sample Data DL_GF_Imp Priority Target Damage Per Second
Count 4999
Mean 17276.88
Minimum 15625.85
Maximum 19520.39
Spread ( max - min ) 3894.54
Range [ ( max - min ) / 2 * 100% ] 11.27%
Standard Deviation 583.1848
5th Percentile 16393.45
95th Percentile 18312.89
( 95th Percentile - 5th Percentile ) 1919.44
Mean Distribution
Standard Deviation 8.2483
95.00% Confidence Intervall ( 17260.71 - 17293.04 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4378
0.1 Scale Factor Error with Delta=300 2904
0.05 Scale Factor Error with Delta=300 11614
0.01 Scale Factor Error with Delta=300 290333
DPS(e)
Sample Data DL_GF_Imp Damage Per Second (Effective)
Count 4999
Mean 17276.88
Minimum 15625.85
Maximum 19520.39
Spread ( max - min ) 3894.54
Range [ ( max - min ) / 2 * 100% ] 11.27%
Damage
Sample Data DL_GF_Imp Damage
Count 4999
Mean 1241742.12
Minimum 898713.22
Maximum 1707543.04
Spread ( max - min ) 808829.82
Range [ ( max - min ) / 2 * 100% ] 32.57%
DTPS
Sample Data DL_GF_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_GF_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_GF_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_GF_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_GF_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_GF_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_GF_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_GF_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.81 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.50 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.34 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.30 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.69 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.94 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.78 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.92 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKSKKKIHKFKHIIHIHIIHKKHIIHIHIKKFKEHIIHKKHIIHKKFKHIKHKKKHKKKKKHFIHIKKEG8HKKKKFKHKKIHIHIDIHIIKFHKKHIKHKIIEHIKKFHIHIKHKKKKKaKYKKKaKKKXSSVST9AVPQVSVSKSKSKKKHIIHIKKFHIHKKKHKIHIIKHFKKEIHDKIHIIHKIKFHKKHKKKHKKKIHIFHKKGKEKHKKKKFHK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.277 nether_portal_active O grimoire_felguard Fluffy_Pillow 99277.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.260 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.568 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), overwhelming_power(25), archive_of_the_titans, battle_potion_of_intellect
0:04.701 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), overwhelming_power(24), archive_of_the_titans, battle_potion_of_intellect
0:05.554 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), overwhelming_power(23), archive_of_the_titans(2), battle_potion_of_intellect
0:06.699 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect
0:06.699 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.699 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.671 nether_portal_active S hand_of_guldan Fluffy_Pillow 96976.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.424 build_a_shard K shadow_bolt Fluffy_Pillow 97729.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.406 nether_portal_active S hand_of_guldan Fluffy_Pillow 96711.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), overwhelming_power(19), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.161 build_a_shard K shadow_bolt Fluffy_Pillow 97466.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), overwhelming_power(18), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.155 nether_portal_active S hand_of_guldan Fluffy_Pillow 96460.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), overwhelming_power(17), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.910 build_a_shard K shadow_bolt Fluffy_Pillow 97215.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), overwhelming_power(17), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.878 nether_portal_active S hand_of_guldan Fluffy_Pillow 96183.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), overwhelming_power(16), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.633 build_a_shard K shadow_bolt Fluffy_Pillow 96938.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), overwhelming_power(15), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.615 nether_portal_active S hand_of_guldan Fluffy_Pillow 95920.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), overwhelming_power(14), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.369 build_a_shard K shadow_bolt Fluffy_Pillow 96674.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), overwhelming_power(13), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.332 nether_portal_active S hand_of_guldan Fluffy_Pillow 95637.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(12), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.086 build_a_shard K shadow_bolt Fluffy_Pillow 96391.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(11), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.199 nether_portal_active S hand_of_guldan Fluffy_Pillow 95504.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(10), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.038 build_a_shard K shadow_bolt Fluffy_Pillow 96343.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(9), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.130 build_a_shard K shadow_bolt Fluffy_Pillow 95435.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation, overwhelming_power(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.227 build_a_shard K shadow_bolt Fluffy_Pillow 94532.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.325 default I demonbolt Fluffy_Pillow 93630.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.149 default H hand_of_guldan Fluffy_Pillow 92454.0/100000: 92% mana | 5.0/5: 100% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(5), ignition_mages_fuse(5)
0:23.955 build_a_shard K shadow_bolt Fluffy_Pillow 93260.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.026 default F call_dreadstalkers Fluffy_Pillow 92331.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.781 build_a_shard K shadow_bolt Fluffy_Pillow 93086.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.756 default H hand_of_guldan Fluffy_Pillow 92061.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(24), archive_of_the_titans(6)
0:27.596 default I demonbolt Fluffy_Pillow 92901.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(6)
0:28.442 default I demonbolt Fluffy_Pillow 91747.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(6)
0:29.293 default H hand_of_guldan Fluffy_Pillow 90598.0/100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(3), overwhelming_power(21), archive_of_the_titans(6)
0:30.148 default I demonbolt Fluffy_Pillow 91453.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(7)
0:31.003 default H hand_of_guldan Fluffy_Pillow 90308.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(19), archive_of_the_titans(7)
0:31.861 default I demonbolt Fluffy_Pillow 91166.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(7)
0:32.685 default I demonbolt Fluffy_Pillow 89990.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(7)
0:33.513 default H hand_of_guldan Fluffy_Pillow 88818.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(7)
0:34.345 build_a_shard K shadow_bolt Fluffy_Pillow 89650.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(7)
0:35.460 build_a_shard K shadow_bolt Fluffy_Pillow 88765.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(8)
0:36.579 default H hand_of_guldan Fluffy_Pillow 87884.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(8)
0:37.426 default I demonbolt Fluffy_Pillow 88731.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(8)
0:38.274 default I demonbolt Fluffy_Pillow 87579.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(8)
0:39.131 default H hand_of_guldan Fluffy_Pillow 86436.0/100000: 86% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(8)
0:39.990 default I demonbolt Fluffy_Pillow 87295.0/100000: 87% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(8)
0:40.851 default H hand_of_guldan Fluffy_Pillow 86156.0/100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(9)
0:41.716 default I demonbolt Fluffy_Pillow 87021.0/100000: 87% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(9)
0:42.843 build_a_shard K shadow_bolt Fluffy_Pillow 86148.0/100000: 86% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), overwhelming_power(8), archive_of_the_titans(9)
0:44.461 build_a_shard K shadow_bolt Fluffy_Pillow 85766.0/100000: 86% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(9), overwhelming_power(6), archive_of_the_titans(9)
0:46.100 default F call_dreadstalkers Fluffy_Pillow 85405.0/100000: 85% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), overwhelming_power(4), archive_of_the_titans(10)
0:47.348 build_a_shard K shadow_bolt Fluffy_Pillow 86653.0/100000: 87% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(3), archive_of_the_titans(10)
0:49.019 default E summon_vilefiend Fluffy_Pillow 86324.0/100000: 86% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(10)
0:50.700 default H hand_of_guldan Fluffy_Pillow 88005.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:51.968 default I demonbolt Fluffy_Pillow 89273.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core(2), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:53.238 default I demonbolt Fluffy_Pillow 88543.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps, dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:54.506 default H hand_of_guldan Fluffy_Pillow 87811.0/100000: 88% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(24), archive_of_the_titans(11)
0:55.610 build_a_shard K shadow_bolt Fluffy_Pillow 88915.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(23), archive_of_the_titans(12)
0:57.083 build_a_shard K shadow_bolt Fluffy_Pillow 88388.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(12)
0:58.571 default H hand_of_guldan Fluffy_Pillow 87876.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(12)
0:59.692 default I demonbolt Fluffy_Pillow 88997.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(19), archive_of_the_titans(12)
1:00.820 default I demonbolt Fluffy_Pillow 88125.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(18), archive_of_the_titans(13)
1:01.955 default H hand_of_guldan Fluffy_Pillow 87260.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(13)
1:03.096 build_a_shard K shadow_bolt Fluffy_Pillow 88401.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(13)
1:04.545 build_a_shard K shadow_bolt Fluffy_Pillow 87850.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power(24), archive_of_the_titans(13)
1:06.002 default F call_dreadstalkers Fluffy_Pillow 87307.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(14)
1:07.205 build_a_shard K shadow_bolt Fluffy_Pillow 88510.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(14)
1:08.685 default H hand_of_guldan Fluffy_Pillow 87990.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(20), archive_of_the_titans(14)
1:09.800 default I demonbolt Fluffy_Pillow 89105.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(14)
1:10.916 build_a_shard K shadow_bolt Fluffy_Pillow 88221.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(15)
1:12.411 default H hand_of_guldan Fluffy_Pillow 87716.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(15)
1:13.497 build_a_shard K shadow_bolt Fluffy_Pillow 88802.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(15)
1:14.952 build_a_shard K shadow_bolt Fluffy_Pillow 88257.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(15)
1:16.416 build_a_shard K shadow_bolt Fluffy_Pillow 87721.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(16)
1:17.894 default H hand_of_guldan Fluffy_Pillow 87199.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(16)
1:19.009 build_a_shard K shadow_bolt Fluffy_Pillow 88314.0/100000: 88% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(16)
1:20.513 build_a_shard K shadow_bolt Fluffy_Pillow 87818.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(17)
1:22.026 build_a_shard K shadow_bolt Fluffy_Pillow 87331.0/100000: 87% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(17)
1:23.555 build_a_shard K shadow_bolt Fluffy_Pillow 86860.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(5), archive_of_the_titans(17)
1:25.194 build_a_shard K shadow_bolt Fluffy_Pillow 86499.0/100000: 86% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(3), archive_of_the_titans(18)
1:26.854 default H hand_of_guldan Fluffy_Pillow 86159.0/100000: 86% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(2), archive_of_the_titans(18)
1:28.105 default F call_dreadstalkers Fluffy_Pillow 87410.0/100000: 87% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation, archive_of_the_titans(18)
1:29.371 default I demonbolt Fluffy_Pillow 88676.0/100000: 89% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps, dreadstalkers(2), quick_navigation, archive_of_the_titans(18)
1:30.640 default H hand_of_guldan Fluffy_Pillow 87945.0/100000: 88% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:31.908 default I demonbolt Fluffy_Pillow 89213.0/100000: 89% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:33.179 build_a_shard K shadow_bolt Fluffy_Pillow 88484.0/100000: 88% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:34.869 build_a_shard K shadow_bolt Fluffy_Pillow 88174.0/100000: 88% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:36.548 default E summon_vilefiend Fluffy_Pillow 87853.0/100000: 88% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
1:38.226 default G summon_demonic_tyrant Fluffy_Pillow 89531.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:39.905 default 8 potion Fluffy_Pillow 89210.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:39.905 default H hand_of_guldan Fluffy_Pillow 89210.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:41.166 build_a_shard K shadow_bolt Fluffy_Pillow 90471.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:42.846 build_a_shard K shadow_bolt Fluffy_Pillow 90151.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:44.525 build_a_shard K shadow_bolt Fluffy_Pillow 89830.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:46.206 build_a_shard K shadow_bolt Fluffy_Pillow 89511.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:47.885 default F call_dreadstalkers Fluffy_Pillow 89190.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:49.774 build_a_shard K shadow_bolt Fluffy_Pillow 91079.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(5), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:51.435 default H hand_of_guldan Fluffy_Pillow 90740.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(5), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:52.682 build_a_shard K shadow_bolt Fluffy_Pillow 91987.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(5), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:54.340 build_a_shard K shadow_bolt Fluffy_Pillow 91645.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(7), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:56.000 default I demonbolt Fluffy_Pillow 91305.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(3), supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:57.247 default H hand_of_guldan Fluffy_Pillow 90552.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.493 default I demonbolt Fluffy_Pillow 91798.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:59.739 default H hand_of_guldan Fluffy_Pillow 91044.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:00.988 default I demonbolt Fluffy_Pillow 92293.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:02.232 default D grimoire_felguard Fluffy_Pillow 91537.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.476 default I demonbolt Fluffy_Pillow 92781.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.722 default H hand_of_guldan Fluffy_Pillow 92027.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:05.967 default I demonbolt Fluffy_Pillow 93272.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
2:07.213 default I demonbolt Fluffy_Pillow 92518.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
2:08.460 build_a_shard K shadow_bolt Fluffy_Pillow 91765.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(7), grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
2:10.119 default F call_dreadstalkers Fluffy_Pillow 91424.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:11.307 default H hand_of_guldan Fluffy_Pillow 92612.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
2:12.496 build_a_shard K shadow_bolt Fluffy_Pillow 93801.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
2:13.878 build_a_shard K shadow_bolt Fluffy_Pillow 93183.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:15.266 default H hand_of_guldan Fluffy_Pillow 92571.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:16.319 default I demonbolt Fluffy_Pillow 93624.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
2:17.379 build_a_shard K shadow_bolt Fluffy_Pillow 92684.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:18.797 default H hand_of_guldan Fluffy_Pillow 92102.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:19.868 build_a_shard K shadow_bolt Fluffy_Pillow 93173.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
2:21.300 default I demonbolt Fluffy_Pillow 92605.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(5), dreadstalkers(2), overwhelming_power(16), archive_of_the_titans(20)
2:22.459 default I demonbolt Fluffy_Pillow 91764.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), overwhelming_power(15), archive_of_the_titans(20)
2:23.624 default E summon_vilefiend Fluffy_Pillow 90929.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(6), overwhelming_power(14), archive_of_the_titans(20)
2:25.189 default H hand_of_guldan Fluffy_Pillow 92494.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, overwhelming_power(12), archive_of_the_titans(20)
2:26.376 default I demonbolt Fluffy_Pillow 93681.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, overwhelming_power(11), archive_of_the_titans(20)
2:27.572 build_a_shard K shadow_bolt Fluffy_Pillow 92877.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, overwhelming_power(10), archive_of_the_titans(20)
2:29.172 build_a_shard K shadow_bolt Fluffy_Pillow 92477.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, overwhelming_power(8), archive_of_the_titans(20)
2:30.792 default F call_dreadstalkers Fluffy_Pillow 92097.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, overwhelming_power(7), archive_of_the_titans(20)
2:32.015 default H hand_of_guldan Fluffy_Pillow 93320.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(5), archive_of_the_titans(20)
2:33.252 default I demonbolt Fluffy_Pillow 94557.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(4), archive_of_the_titans(20)
2:34.498 default H hand_of_guldan Fluffy_Pillow 93803.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(3), archive_of_the_titans(20)
2:35.751 default I demonbolt Fluffy_Pillow 95056.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
2:37.004 build_a_shard K shadow_bolt Fluffy_Pillow 94309.0/100000: 94% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
2:38.693 default H hand_of_guldan Fluffy_Pillow 93998.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
2:39.961 build_a_shard K shadow_bolt Fluffy_Pillow 95266.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:41.641 build_a_shard K shadow_bolt Fluffy_Pillow 94946.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(8), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:43.321 build_a_shard K shadow_bolt Fluffy_Pillow 94626.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation(2), archive_of_the_titans(20)
2:44.998 build_a_shard K shadow_bolt Fluffy_Pillow 94303.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), archive_of_the_titans(20)
2:46.679 build_a_shard K shadow_bolt Fluffy_Pillow 93984.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:48.350 nether_portal_building a hand_of_guldan Fluffy_Pillow 93655.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:49.597 build_a_shard K shadow_bolt Fluffy_Pillow 94902.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation(4), archive_of_the_titans(20)
2:51.256 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 94561.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation(4), archive_of_the_titans(20)
2:52.499 build_a_shard K shadow_bolt Fluffy_Pillow 95804.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:54.160 build_a_shard K shadow_bolt Fluffy_Pillow 95465.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:55.821 build_a_shard K shadow_bolt Fluffy_Pillow 95126.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:57.480 nether_portal_building a hand_of_guldan Fluffy_Pillow 94785.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:58.726 build_a_shard K shadow_bolt Fluffy_Pillow 96031.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:00.387 build_a_shard K shadow_bolt Fluffy_Pillow 95692.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(2), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:02.047 build_a_shard K shadow_bolt Fluffy_Pillow 95352.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:03.707 nether_portal_building X nether_portal Fluffy_Pillow 95012.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
3:04.954 nether_portal_active S hand_of_guldan Fluffy_Pillow 96259.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(3), portal_summons, quick_navigation(4), archive_of_the_titans(20)
3:06.200 nether_portal_active S hand_of_guldan Fluffy_Pillow 97505.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(3), portal_summons(2), quick_navigation(4), archive_of_the_titans(20)
3:07.445 nether_portal_active V demonbolt Fluffy_Pillow 98750.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(4), demonic_calling, nether_portal, wild_imps(4), prince_malchezaar, portal_summons(3), quick_navigation(4), archive_of_the_titans(20)
3:08.691 nether_portal_active S hand_of_guldan Fluffy_Pillow 97996.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), prince_malchezaar, portal_summons(3), quick_navigation(4), archive_of_the_titans(20)
3:09.936 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 99241.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, nether_portal, wild_imps(5), prince_malchezaar, portal_summons(4), quick_navigation_final, archive_of_the_titans(20)
3:11.517 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, prince_malchezaar, portal_summons(4), quick_navigation_final, archive_of_the_titans(20)
3:11.517 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, prince_malchezaar, portal_summons(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse
3:11.517 nether_portal_active V demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, prince_malchezaar, portal_summons(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse
3:12.519 nether_portal_active P summon_vilefiend Fluffy_Pillow 97005.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), tyrant, prince_malchezaar, portal_summons(4), quick_navigation_final, archive_of_the_titans(20), ignition_mages_fuse
3:13.853 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98339.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, prince_malchezaar, portal_summons(5), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse
3:14.732 nether_portal_active V demonbolt Fluffy_Pillow 99218.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(6), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse
3:15.615 nether_portal_active S hand_of_guldan Fluffy_Pillow 98101.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(6), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(2)
3:16.478 nether_portal_active V demonbolt Fluffy_Pillow 98964.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(2)
3:17.345 nether_portal_active S hand_of_guldan Fluffy_Pillow 97831.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(7), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.216 build_a_shard K shadow_bolt Fluffy_Pillow 98702.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.381 nether_portal_active S hand_of_guldan Fluffy_Pillow 97867.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.263 build_a_shard K shadow_bolt Fluffy_Pillow 98749.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(3)
3:21.481 nether_portal_active S hand_of_guldan Fluffy_Pillow 97967.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.400 build_a_shard K shadow_bolt Fluffy_Pillow 98886.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.815 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(13), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(4)
3:25.198 build_a_shard K shadow_bolt Fluffy_Pillow 97388.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(13), dreadstalkers(2), vilefiend, tyrant, prince_malchezaar, portal_summons(8), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(4)
3:26.596 default H hand_of_guldan Fluffy_Pillow 96786.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(13), vilefiend, prince_malchezaar, portal_summons(8), overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.650 default I demonbolt Fluffy_Pillow 97840.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(13), vilefiend, prince_malchezaar, portal_summons(8), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse(5)
3:28.679 default I demonbolt Fluffy_Pillow 96869.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(13), vilefiend, prince_malchezaar, portal_summons(8), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(5)
3:29.714 default H hand_of_guldan Fluffy_Pillow 95904.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(16), prince_malchezaar, portal_summons(8), quick_navigation, overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.749 default I demonbolt Fluffy_Pillow 96939.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), prince_malchezaar, portal_summons(8), quick_navigation, overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.788 build_a_shard K shadow_bolt Fluffy_Pillow 95978.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(12), prince_malchezaar, portal_summons(8), quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
3:33.408 build_a_shard K shadow_bolt Fluffy_Pillow 95598.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), prince_malchezaar, quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
3:35.048 default F call_dreadstalkers Fluffy_Pillow 95238.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), prince_malchezaar, quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
3:36.294 default H hand_of_guldan Fluffy_Pillow 96484.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(5), dreadstalkers(2), prince_malchezaar, quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
3:37.547 default I demonbolt Fluffy_Pillow 97737.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(20)
3:38.807 default H hand_of_guldan Fluffy_Pillow 96997.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:40.075 build_a_shard K shadow_bolt Fluffy_Pillow 98265.0/100000: 98% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:41.753 build_a_shard K shadow_bolt Fluffy_Pillow 97943.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:43.432 build_a_shard K shadow_bolt Fluffy_Pillow 97622.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:45.103 default H hand_of_guldan Fluffy_Pillow 97293.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:46.356 build_a_shard K shadow_bolt Fluffy_Pillow 98546.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:48.024 default I demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(5), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(20)
3:49.112 default H hand_of_guldan Fluffy_Pillow 97091.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(24), archive_of_the_titans(20)
3:50.204 default I demonbolt Fluffy_Pillow 98183.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(20)
3:51.302 default I demonbolt Fluffy_Pillow 97281.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20)
3:52.407 build_a_shard K shadow_bolt Fluffy_Pillow 96386.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(20)
3:53.887 default H hand_of_guldan Fluffy_Pillow 95866.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(20), archive_of_the_titans(20)
3:55.004 default F call_dreadstalkers Fluffy_Pillow 96983.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
3:56.177 build_a_shard K shadow_bolt Fluffy_Pillow 98156.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
3:57.689 build_a_shard K shadow_bolt Fluffy_Pillow 97668.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(20)
3:59.202 default E summon_vilefiend Fluffy_Pillow 97181.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(20)
4:00.731 default I demonbolt Fluffy_Pillow 98710.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(13), archive_of_the_titans(20)
4:01.883 default H hand_of_guldan Fluffy_Pillow 97862.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20)
4:03.045 default D grimoire_felguard Fluffy_Pillow 99024.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20)
4:04.219 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(2), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20)
4:05.791 default I demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(8), archive_of_the_titans(20)
4:06.980 default H hand_of_guldan Fluffy_Pillow 97192.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(7), archive_of_the_titans(20)
4:08.172 default I demonbolt Fluffy_Pillow 98384.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(5), archive_of_the_titans(20)
4:09.379 default I demonbolt Fluffy_Pillow 97591.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20)
4:10.596 default H hand_of_guldan Fluffy_Pillow 96808.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
4:11.682 build_a_shard K shadow_bolt Fluffy_Pillow 97894.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), vilefiend, grimoire_felguard, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
4:13.136 default I demonbolt Fluffy_Pillow 97348.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
4:14.196 build_a_shard K shadow_bolt Fluffy_Pillow 96408.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
4:15.617 default F call_dreadstalkers Fluffy_Pillow 95829.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
4:16.689 default H hand_of_guldan Fluffy_Pillow 96901.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
4:17.766 build_a_shard K shadow_bolt Fluffy_Pillow 97978.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
4:19.207 build_a_shard K shadow_bolt Fluffy_Pillow 97419.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
4:20.664 default H hand_of_guldan Fluffy_Pillow 96876.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
4:21.764 build_a_shard K shadow_bolt Fluffy_Pillow 97976.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
4:23.235 build_a_shard K shadow_bolt Fluffy_Pillow 97447.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), overwhelming_power(11), archive_of_the_titans(20)
4:24.828 build_a_shard K shadow_bolt Fluffy_Pillow 97040.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(10), archive_of_the_titans(20)
4:26.429 default H hand_of_guldan Fluffy_Pillow 96641.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), overwhelming_power(8), archive_of_the_titans(20)
4:27.642 build_a_shard K shadow_bolt Fluffy_Pillow 97854.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), overwhelming_power(7), archive_of_the_titans(20)
4:29.273 build_a_shard K shadow_bolt Fluffy_Pillow 97485.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), overwhelming_power(5), archive_of_the_titans(20)
4:30.922 build_a_shard K shadow_bolt Fluffy_Pillow 97134.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), quick_navigation, overwhelming_power(4), archive_of_the_titans(20)
4:32.573 default I demonbolt Fluffy_Pillow 96785.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
4:33.819 default H hand_of_guldan Fluffy_Pillow 96031.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
4:35.072 default I demonbolt Fluffy_Pillow 97284.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:36.331 default F call_dreadstalkers Fluffy_Pillow 96543.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
4:37.591 default H hand_of_guldan Fluffy_Pillow 97803.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:38.853 build_a_shard K shadow_bolt Fluffy_Pillow 99065.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:40.534 build_a_shard K shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:42.215 default G summon_demonic_tyrant Fluffy_Pillow 97687.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:43.884 build_a_shard K shadow_bolt Fluffy_Pillow 97356.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), tyrant, quick_navigation(3), archive_of_the_titans(20)
4:45.554 default E summon_vilefiend Fluffy_Pillow 97026.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), tyrant, quick_navigation(4), archive_of_the_titans(20)
4:47.387 build_a_shard K shadow_bolt Fluffy_Pillow 98859.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:49.049 default H hand_of_guldan Fluffy_Pillow 98007.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:50.236 build_a_shard K shadow_bolt Fluffy_Pillow 99194.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:51.818 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:53.399 build_a_shard K shadow_bolt Fluffy_Pillow 97585.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:54.981 build_a_shard K shadow_bolt Fluffy_Pillow 97167.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20)
4:56.564 default F call_dreadstalkers Fluffy_Pillow 96750.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
4:57.602 default H hand_of_guldan Fluffy_Pillow 97788.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
4:58.646 build_a_shard K shadow_bolt Fluffy_Pillow 98832.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_GF_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

DL_ID_Felguard : 17226 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17226.4 17226.4 15.3 / 0.089% 2170.6 / 12.6% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.5 961.0 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_ID_Felguard 17226
Demonbolt 1336 7.8% 47.1 5.81sec 8515 7489 Direct 47.9 7113 14230 8368 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.06 47.88 0.00 0.00 1.1370 0.0000 400692.01 400692.01 0.00 7488.87 7488.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.44 82.36% 7112.93 6520 8308 7114.45 6923 7336 280524 280524 0.00
crit 8.44 17.64% 14229.79 13040 16616 14234.15 13136 16099 120168 120168 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1099 6.4% 62.9 4.73sec 5242 4747 Direct 62.8 4462 8936 5253 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.88 62.75 0.00 0.00 1.1042 0.0000 329633.45 329633.45 0.00 4747.30 4747.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.67 82.33% 4462.31 1634 5979 4456.58 4077 4855 230554 230554 0.00
crit 11.09 17.67% 8936.09 3267 11958 8922.42 4609 10867 99079 99079 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 36.73sec 8272 0 Direct 7.3 4925 9849 5786 17.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 42271.55 42271.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.03 82.50% 4924.62 4925 4925 4922.65 0 4925 29680 29680 0.00
crit 1.28 17.50% 9849.24 9849 9849 7238.67 0 9849 12592 12592 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.4% 7.3 36.73sec 2486 0 Direct 7.3 2111 4221 2486 17.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.31 0.00 0.00 0.0000 0.0000 18158.18 18158.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.23% 2110.55 2111 2111 2109.71 0 2111 12678 12678 0.00
crit 1.30 17.77% 4221.10 4221 4221 3034.74 0 4221 5480 5480 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1316 7.6% 93.9 3.14sec 4200 2815 Direct 93.3 3593 7188 4229 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.94 93.27 0.00 0.00 1.4921 0.0000 394483.77 394483.77 0.00 2814.56 2814.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.76 82.30% 3593.04 3335 4297 3593.65 3548 3651 275819 275819 0.00
crit 16.51 17.70% 7187.99 6670 8595 7189.26 6961 7585 118664 118664 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 291 1.7% 7.3 36.60sec 11888 0 Direct 7.2 10240 20481 12049 17.7%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 7.23 0.00 0.00 0.0000 0.0000 87157.43 87157.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 82.33% 10240.44 10240 10240 10236.34 0 10240 60978 60978 0.00
crit 1.28 17.67% 20480.88 20481 20481 15060.56 0 20481 26180 26180 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3160 / 3160
Felstorm 379 2.2% 10.4 30.14sec 10913 2904 Periodic 62.1 1556 3112 1830 17.6% 13.0%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 0.00 62.11 62.11 3.7578 0.6302 113674.51 162511.36 30.05 2904.23 2904.23
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.2 82.38% 1556.24 1454 1910 1556.25 1521 1590 79627 113836 30.05
crit 10.9 17.62% 3111.82 2908 3820 3111.81 2940 3639 34048 48675 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1059 6.2% 58.4 5.10sec 5433 5409 Direct 58.4 4626 9251 5434 17.5%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.40 58.40 0.00 0.00 1.0045 0.0000 317300.07 453618.55 30.05 5409.23 5409.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.21 82.55% 4626.29 4179 5592 4626.95 4520 4732 223011 318821 30.05
crit 10.19 17.45% 9251.33 8359 11183 9253.21 8503 10566 94289 134797 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1722 10.0% 173.6 1.71sec 2972 2004 Direct 173.6 2527 5055 2972 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.60 173.60 0.00 0.00 1.4831 0.0000 516023.32 737717.31 30.05 2004.21 2004.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.03 82.39% 2527.38 2284 3056 2527.77 2488 2575 361489 516793 30.05
crit 30.57 17.61% 5054.94 4569 6113 5055.87 4808 5393 154534 220925 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - urzul 1303 / 197
Many Faced Bite 489 0.4% 10.5 12.75sec 2084 2084 Direct 10.5 1778 3549 2084 17.3%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.55 10.55 0.00 0.00 1.0000 0.0000 21982.31 31426.35 30.05 2084.22 2084.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.72 82.69% 1777.57 1519 2032 1774.94 0 2032 15503 22163 30.01
crit 1.83 17.31% 3549.03 3037 4064 2800.79 0 4064 6479 9263 23.72
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 814 0.7% 46.9 2.80sec 776 650 Direct 46.9 659 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.91 46.91 0.00 0.00 1.1938 0.0000 36385.66 52017.68 30.05 649.67 649.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.65 82.39% 659.39 562 753 658.62 569 749 25486 36435 30.05
crit 8.26 17.61% 1319.16 1125 1505 1299.91 0 1505 10900 15583 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - darkhound 1276 / 194
Fel Bite 462 0.4% 9.9 13.68sec 2093 2093 Direct 9.9 1779 3558 2093 17.6%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.95 9.95 0.00 0.00 1.0000 0.0000 20822.46 29768.21 30.05 2093.13 2093.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.19 82.35% 1779.30 1519 2032 1775.93 0 2032 14576 20839 29.98
crit 1.76 17.65% 3557.62 3037 4064 2777.15 0 4064 6246 8929 23.45
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 814 0.7% 47.0 2.81sec 776 649 Direct 47.0 660 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.05 47.05 0.00 0.00 1.1949 0.0000 36488.76 52165.06 30.05 649.07 649.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.78 82.42% 659.61 562 753 658.97 569 737 25578 36567 30.05
crit 8.27 17.58% 1319.22 1125 1505 1301.61 0 1505 10910 15598 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3122 / 1559
Bile Spit 1096 3.2% 6.8 47.19sec 23933 0 Direct 6.8 8824 17653 10380 17.6%  
Periodic 33.4 2777 0 2777 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.44 33.44 0.0000 2.0000 163746.51 163746.51 0.00 2448.36 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.63 82.37% 8823.60 8474 10104 8823.87 8630 9649 49641 49641 0.00
crit 1.20 17.63% 17653.34 16947 20207 12915.36 0 20207 21252 21252 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2776.70 2502 3310 2776.84 2622 2868 92854 92854 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 732 2.1% 30.1 9.84sec 3647 3647 Direct 30.1 3100 6197 3647 17.7%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.09 30.09 0.00 0.00 1.0000 0.0000 109742.83 156890.55 30.05 3647.03 3647.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.78 82.34% 3099.90 2737 3621 3100.67 2942 3218 76802 109798 30.05
crit 5.32 17.66% 6197.11 5474 7243 6187.08 0 7243 32941 47093 30.00
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1294 3.8% 107.8 2.72sec 1795 1339 Direct 107.8 1526 3052 1795 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.80 107.80 0.00 0.00 1.3411 0.0000 193556.68 276712.52 30.05 1338.76 1338.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.74 82.31% 1525.55 1337 1775 1525.87 1455 1567 135371 193529 30.05
crit 19.07 17.69% 3051.69 2673 3550 3052.47 2795 3280 58185 83183 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - void_terror 1781 / 269
Double Breath 0 (146) 0.0% (0.8%) 0.0 0.00sec 0 7315

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7314.51 7314.51
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 484 0.4% 7.8 17.09sec 2785 0 Direct 7.8 2367 4732 2785 17.7%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.80 7.80 0.00 0.00 0.0000 0.0000 21714.63 21714.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 82.32% 2367.26 2026 2711 2357.23 0 2711 15192 15192 0.00
crit 1.38 17.68% 4732.19 4053 5422 3353.92 0 5422 6523 6523 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 484 0.4% 7.8 17.09sec 2785 0 Direct 7.8 2367 4736 2785 17.7%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.80 7.80 0.00 0.00 0.0000 0.0000 21711.63 21711.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 82.35% 2366.89 2026 2711 2361.84 0 2668 15195 15195 0.00
crit 1.38 17.65% 4735.64 4053 5422 3379.22 0 5422 6517 6517 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 813 0.7% 46.8 2.69sec 776 651 Direct 46.8 660 1320 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.81 46.81 0.00 0.00 1.1928 0.0000 36340.80 51953.54 30.05 650.91 650.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.53 82.31% 659.60 562 753 659.04 565 737 25414 36332 30.05
crit 8.28 17.69% 1319.78 1125 1505 1302.23 0 1505 10927 15621 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3639 / 2399
Dreadbite 1335 5.1% 29.0 21.05sec 9081 0 Direct 29.0 7720 15434 9080 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.0000 0.0000 263787.14 263787.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.93 82.36% 7719.96 7139 9517 7720.17 7434 7939 184712 184712 0.00
crit 5.12 17.64% 15434.44 14278 19033 15357.68 0 19033 79075 79075 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2304 8.8% 311.5 1.90sec 1463 1106 Direct 311.5 1243 2485 1463 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.49 311.49 0.00 0.00 1.3223 0.0000 455656.88 651416.23 30.05 1106.27 1106.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.27 82.27% 1242.56 1105 1473 1242.73 1225 1262 318428 455231 30.05
crit 55.22 17.73% 2485.06 2211 2947 2485.37 2366 2606 137229 196186 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3112 / 3043
Fel Firebolt 3112 17.7% 1217.1 0.24sec 749 507 Direct 1212.1 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1217.08 1212.15 0.00 0.00 1.4772 0.0000 912198.14 912198.14 0.00 507.36 507.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 998.19 82.35% 639.61 569 761 639.69 630 651 638450 638450 0.00
crit 213.96 17.65% 1279.45 1138 1523 1279.61 1249 1323 273748 273748 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4676 / 823
Demonfire 4676 4.8% 37.7 6.90sec 6540 4903 Direct 37.6 5561 11123 6554 17.9%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.66 37.58 0.00 0.00 1.3337 0.0000 246275.94 246275.94 0.00 4903.45 4903.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.87 82.15% 5561.44 5029 5917 5564.83 5462 5676 171670 171670 0.00
crit 6.71 17.85% 11122.68 10059 11834 11118.72 0 11834 74606 74606 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - shivarra 1893 / 288
melee 813 0.7% 47.2 2.80sec 776 650 Direct 47.2 659 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.16 47.16 0.00 0.00 1.1945 0.0000 36585.51 52303.38 30.05 649.51 649.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.84 82.36% 659.47 562 753 658.55 570 739 25611 36614 30.05
crit 8.32 17.64% 1319.20 1125 1505 1298.88 0 1505 10974 15689 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 407 0.4% 47.2 2.80sec 388 307 Direct 47.2 330 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.16 47.16 0.00 0.00 1.2643 0.0000 18303.41 26166.93 30.05 307.01 307.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.80 82.28% 329.78 281 376 329.32 285 370 12795 18292 30.05
crit 8.36 17.72% 659.13 562 753 649.39 0 741 5508 7875 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (102) 0.0% (0.6%) 0.0 0.00sec 0 3931

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3931.00 3931.00
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.7 18.21sec 981 0 Direct 7.7 836 1668 981 17.5%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.72 7.72 0.00 0.00 0.0000 0.0000 7576.39 10831.36 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.50% 835.70 717 959 831.85 0 959 5322 7609 29.93
crit 1.35 17.50% 1668.30 1434 1919 1167.06 0 1919 2254 3222 21.01
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 168 0.1% 7.7 18.21sec 981 0 Direct 7.7 835 1671 981 17.5%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.72 7.72 0.00 0.00 0.0000 0.0000 7576.80 10831.95 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.52% 835.41 717 959 832.04 0 959 5322 7608 29.94
crit 1.35 17.48% 1671.05 1434 1919 1179.10 0 1919 2255 3223 21.21
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 168 0.1% 7.7 18.21sec 985 0 Direct 7.7 835 1670 985 17.9%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.72 7.72 0.00 0.00 0.0000 0.0000 7603.95 10870.77 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.09% 835.47 717 959 832.04 0 948 5295 7570 29.94
crit 1.38 17.91% 1670.46 1434 1919 1179.10 0 1919 2309 3301 21.21
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.1% 7.7 18.21sec 983 0 Direct 7.7 835 1671 983 17.6%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.72 7.72 0.00 0.00 0.0000 0.0000 7586.26 10845.46 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 82.38% 835.40 717 959 831.26 0 959 5313 7595 29.91
crit 1.36 17.62% 1671.11 1434 1919 1181.14 0 1919 2274 3250 21.25
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - illidari_satyr 1250 / 191
melee 409 0.4% 47.7 2.81sec 388 324 Direct 47.7 330 659 388 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.66 47.66 0.00 0.00 1.1961 0.0000 18475.21 26412.53 30.05 324.08 324.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.29 82.42% 329.71 281 376 329.28 284 374 12953 18518 30.05
crit 8.38 17.58% 659.18 562 753 649.44 0 753 5522 7894 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 205 0.2% 47.7 2.81sec 194 153 Direct 47.7 165 330 194 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.66 47.66 0.00 0.00 1.2660 0.0000 9241.17 13211.37 30.05 153.15 153.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.27 82.39% 164.84 141 188 164.64 142 187 6473 9254 30.05
crit 8.40 17.61% 329.73 281 376 324.89 0 376 2768 3957 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 637 0.6% 10.3 13.25sec 2796 2796 Direct 10.3 2375 4745 2796 17.7%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.33 10.33 0.00 0.00 1.0000 0.0000 28876.94 28876.94 0.00 2795.71 2795.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.50 82.26% 2375.39 2026 2711 2370.15 0 2711 20184 20184 0.00
crit 1.83 17.74% 4744.80 4053 5422 3745.61 0 5422 8693 8693 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3838 / 581
Toxic Bile 3838 3.3% 61.5 2.09sec 2802 2971 Direct 61.5 2384 4769 2803 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.48 61.45 0.00 0.00 0.9431 0.0000 172267.92 172267.92 0.00 2971.01 2971.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.64 82.41% 2383.81 2026 2711 2379.11 2053 2654 120723 120723 0.00
crit 10.81 17.59% 4768.53 4053 5422 4727.22 0 5422 51545 51545 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - wrathguard 1668 / 254
melee 807 0.7% 46.7 2.76sec 777 650 Direct 46.7 659 1319 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.70 46.70 0.00 0.00 1.1951 0.0000 36283.70 51871.90 30.05 650.15 650.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.37 82.18% 659.49 562 753 658.59 565 749 25308 36180 30.05
crit 8.32 17.82% 1318.96 1125 1505 1300.81 0 1505 10976 15692 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 403 0.4% 46.7 2.76sec 388 307 Direct 46.7 330 660 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.70 46.70 0.00 0.00 1.2650 0.0000 18109.70 25889.99 30.05 306.59 306.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.47 82.39% 329.74 281 376 329.27 283 376 12686 18136 30.05
crit 8.22 17.61% 659.51 562 753 650.37 0 753 5424 7754 29.66
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 458 0.4% 9.9 13.37sec 2093 2093 Direct 9.9 1780 3554 2093 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.88 9.88 0.00 0.00 1.0000 0.0000 20690.39 29579.39 30.05 2093.32 2093.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.14 82.33% 1779.66 1519 2032 1776.65 0 2032 14483 20705 30.00
crit 1.75 17.67% 3553.58 3037 4064 2711.99 0 4064 6207 8874 22.94
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4517 / 395
melee 3010 1.5% 21.1 1.60sec 3688 3086 Direct 21.1 3125 6253 3688 18.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.07 21.07 0.00 0.00 1.1951 0.0000 77703.80 111086.91 30.05 3085.69 3085.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 82.02% 3125.20 2665 3566 3115.92 2699 3566 54010 77213 30.05
crit 3.79 17.98% 6253.23 5330 7131 5941.44 0 7131 23694 33874 28.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1507 0.8% 21.1 1.60sec 1844 1458 Direct 21.1 1563 3122 1844 18.0%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.07 21.07 0.00 0.00 1.2651 0.0000 38856.18 55549.58 30.05 1457.64 1457.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.27 81.98% 1563.11 1333 1783 1558.33 1349 1783 27001 38601 30.05
crit 3.80 18.02% 3122.00 2665 3566 3021.45 0 3566 11856 16949 29.15
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vicious_hellhound 1044 / 159
Demon Fangs 648 0.6% 10.5 12.70sec 2791 2791 Direct 10.5 2373 4748 2791 17.6%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.53 10.53 0.00 0.00 1.0000 0.0000 29378.42 29378.42 0.00 2791.03 2791.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.67 82.40% 2373.02 2026 2711 2368.81 0 2711 20585 20585 0.00
crit 1.85 17.60% 4747.74 4053 5422 3740.51 0 5422 8793 8793 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 397 0.3% 92.0 1.41sec 195 318 Direct 92.0 165 331 195 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.95 91.95 0.00 0.00 0.6108 0.0000 17887.05 25571.69 30.05 318.47 318.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.66 82.28% 165.23 141 188 164.94 142 188 12501 17872 30.05
crit 16.30 17.72% 330.50 281 376 329.23 0 376 5386 7700 29.97
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 972 / 81
Eye of Gul'dan 972 0.5% 28.1 4.83sec 863 1131 Periodic 60.7 399 0 399 0.0% 59.5%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.06 0.00 60.74 60.74 0.7627 2.9389 24217.21 24217.21 0.00 121.14 1131.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.7 100.00% 398.70 76 484 396.71 0 430 24217 24217 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_ID_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.95sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.05sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2036 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Felguard
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2382 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.56sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5081 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 17.8 14.64sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.19sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5526 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.31% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.6 23.3sec 10.2sec 52.03% 83.69% 15.6(15.6) 0.1

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.03%

Trigger Attempt Success

  • trigger_pct:19.97%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.5 32.1 11.7sec 5.0sec 40.33% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.56%
  • demonic_core_2:15.86%
  • demonic_core_3:5.44%
  • demonic_core_4:2.48%

Trigger Attempt Success

  • trigger_pct:23.61%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.1sec 65.94% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.60%
  • dreadstalkers_4:6.33%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 153.9sec 2.2sec 1.34% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.83% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.96% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 66.9sec 36.8sec 44.00% 0.00% 2.9(40.6) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.81%
  • overwhelming_power_15:1.86%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.97%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.14%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.3 182.9sec 14.5sec 19.53% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.71%
  • portal_summons_2:0.78%
  • portal_summons_3:1.25%
  • portal_summons_4:1.53%
  • portal_summons_5:1.86%
  • portal_summons_6:1.83%
  • portal_summons_7:3.93%
  • portal_summons_8:5.92%
  • portal_summons_9:0.73%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 154.8sec 101.1sec 1.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.3 52.4sec 10.4sec 67.48% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.60%
  • quick_navigation_2:17.22%
  • quick_navigation_3:16.48%
  • quick_navigation_4:16.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.4sec 52.4sec 17.44% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.9sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.98% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.98%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.2 133.1sec 0.0sec 97.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.40%
  • wild_imps_2:2.02%
  • wild_imps_3:10.36%
  • wild_imps_4:20.94%
  • wild_imps_5:8.13%
  • wild_imps_6:14.87%
  • wild_imps_7:18.58%
  • wild_imps_8:5.05%
  • wild_imps_9:3.54%
  • wild_imps_10:3.94%
  • wild_imps_11:4.17%
  • wild_imps_12:1.70%
  • wild_imps_13:1.21%
  • wild_imps_14:1.28%
  • wild_imps_15:0.36%
  • wild_imps_16:0.15%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DL_ID_Felguard
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 13.9sec
one_shard_hog 9.0 21.9sec
two_shard_hog 4.2 48.7sec
three_shard_hog 49.7 5.7sec
portal_summon 15.3 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_ID_Felguard
call_dreadstalkers Soul Shard 14.6 16.9 1.2 1.2 0.0
demonbolt Mana 48.1 96123.5 2000.0 2042.6 4.2
hand_of_guldan Soul Shard 62.9 166.5 2.6 2.6 1979.4
shadow_bolt Mana 93.9 187865.3 2000.0 1999.9 2.1
summon_demonic_tyrant Mana 3.6 7162.1 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
felstorm Energy 10.4 624.9 60.0 60.0 181.9
legion_strike Energy 58.4 3503.8 60.0 60.0 90.6
pet - wild_imp
fel_firebolt Energy 1217.1 18638.1 15.3 15.3 48.9
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 48.06 95.96 (50.54%) 2.00 0.16 0.17%
shadow_bolt Soul Shard 93.93 93.92 (49.46%) 1.00 0.01 0.01%
mana_regen Mana 556.67 288299.40 (100.00%) 517.90 11142.10 3.72%
pet - felguard
energy_regen Energy 375.40 3988.67 (100.00%) 10.63 18.58 0.46%
pet - demonic_tyrant
energy_regen Energy 37.66 0.00 (0.00%) 0.00 760.16 100.00%
pet - bilescourge
energy_regen Energy 13.45 0.00 (0.00%) 0.00 187.03 100.00%
pet - bilescourge
energy_regen Energy 11.75 0.00 (0.00%) 0.00 162.33 100.00%
pet - bilescourge
energy_regen Energy 16.02 0.00 (0.00%) 0.00 222.90 100.00%
pet - bilescourge
energy_regen Energy 13.42 0.00 (0.00%) 0.00 186.36 100.00%
pet - bilescourge
energy_regen Energy 5.41 0.00 (0.00%) 0.00 75.61 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.04 970.55
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97140.79 91558.00 100000.00
Soul Shard 2.57 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DL_ID_Felguard Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_ID_Felguard Damage Per Second
Count 4999
Mean 17226.39
Minimum 15480.65
Maximum 19581.35
Spread ( max - min ) 4100.70
Range [ ( max - min ) / 2 * 100% ] 11.90%
Standard Deviation 553.3413
5th Percentile 16378.62
95th Percentile 18190.71
( 95th Percentile - 5th Percentile ) 1812.09
Mean Distribution
Standard Deviation 7.8262
95.00% Confidence Intervall ( 17211.05 - 17241.73 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3964
0.1 Scale Factor Error with Delta=300 2614
0.05 Scale Factor Error with Delta=300 10456
0.01 Scale Factor Error with Delta=300 261379
Priority Target DPS
Sample Data DL_ID_Felguard Priority Target Damage Per Second
Count 4999
Mean 17226.39
Minimum 15480.65
Maximum 19581.35
Spread ( max - min ) 4100.70
Range [ ( max - min ) / 2 * 100% ] 11.90%
Standard Deviation 553.3413
5th Percentile 16378.62
95th Percentile 18190.71
( 95th Percentile - 5th Percentile ) 1812.09
Mean Distribution
Standard Deviation 7.8262
95.00% Confidence Intervall ( 17211.05 - 17241.73 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3964
0.1 Scale Factor Error with Delta=300 2614
0.05 Scale Factor Error with Delta=300 10456
0.01 Scale Factor Error with Delta=300 261379
DPS(e)
Sample Data DL_ID_Felguard Damage Per Second (Effective)
Count 4999
Mean 17226.39
Minimum 15480.65
Maximum 19581.35
Spread ( max - min ) 4100.70
Range [ ( max - min ) / 2 * 100% ] 11.90%
Damage
Sample Data DL_ID_Felguard Damage
Count 4999
Mean 1272396.38
Minimum 880901.04
Maximum 1687238.65
Spread ( max - min ) 806337.61
Range [ ( max - min ) / 2 * 100% ] 31.69%
DTPS
Sample Data DL_ID_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_ID_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_ID_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_ID_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_ID_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_ID_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_ID_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_ID_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.19 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.96 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.45 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.42 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.10 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.03 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.94 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJQJJJEHGJJHGHGHHGHGJHGHJJJGEHJDGJJJGHHJGJEJGJJJGJJHGJJJJGEHGHHDGF8HJGJJJJEJGJHGHHGJJGHHJGEHGJJJJJDGHHGJEJGJJJJJYJJJYJWJJJYJJJVQQTNJOQR9ATQJQJQJJJGJJJHEGJJGHJGHHGHGHJJJEJDGHGJJJGHHJGJEJGJJJGJJJGJJJHGHEGJJDJJFGJJJJJGE

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active N summon_vilefiend Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, demonic_calling, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.584 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, nether_portal, vilefiend, portal_summons(2), overwhelming_power(25), archive_of_the_titans, battle_potion_of_intellect
0:03.434 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), overwhelming_power(24), archive_of_the_titans, battle_potion_of_intellect
0:04.291 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, overwhelming_power(23), archive_of_the_titans, battle_potion_of_intellect
0:05.431 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, overwhelming_power(22), archive_of_the_titans(2), battle_potion_of_intellect
0:06.290 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98864.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, overwhelming_power(21), archive_of_the_titans(2), battle_potion_of_intellect
0:07.442 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect
0:07.442 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.442 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, overwhelming_power(20), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.419 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96982.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.173 build_a_shard J shadow_bolt Fluffy_Pillow 97736.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.155 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96718.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.908 build_a_shard J shadow_bolt Fluffy_Pillow 97471.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.895 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96458.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.651 build_a_shard J shadow_bolt Fluffy_Pillow 97214.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.614 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96177.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.370 build_a_shard J shadow_bolt Fluffy_Pillow 96933.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.344 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95907.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.099 build_a_shard J shadow_bolt Fluffy_Pillow 96662.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.053 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95616.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(3), overwhelming_power(10), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.809 build_a_shard J shadow_bolt Fluffy_Pillow 96372.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.833 nether_portal_active Q hand_of_guldan Fluffy_Pillow 95396.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.603 build_a_shard J shadow_bolt Fluffy_Pillow 96166.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.607 build_a_shard J shadow_bolt Fluffy_Pillow 95170.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.614 build_a_shard J shadow_bolt Fluffy_Pillow 94177.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(9), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.627 default E call_dreadstalkers Fluffy_Pillow 93190.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.646 default H demonbolt Fluffy_Pillow 94209.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.400 default G hand_of_guldan Fluffy_Pillow 92963.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.152 build_a_shard J shadow_bolt Fluffy_Pillow 93715.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.155 build_a_shard J shadow_bolt Fluffy_Pillow 92718.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.166 default H demonbolt Fluffy_Pillow 91729.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.925 default G hand_of_guldan Fluffy_Pillow 90488.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(6)
0:28.802 default H demonbolt Fluffy_Pillow 91365.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, portal_summons(9), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(6)
0:29.685 default G hand_of_guldan Fluffy_Pillow 90248.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(13), archive_of_the_titans(6)
0:30.575 default H demonbolt Fluffy_Pillow 91138.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(7)
0:31.430 default H demonbolt Fluffy_Pillow 89993.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(7)
0:32.291 default G hand_of_guldan Fluffy_Pillow 88854.0/100000: 89% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(7)
0:33.153 default H demonbolt Fluffy_Pillow 89716.0/100000: 90% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(7)
0:34.021 default G hand_of_guldan Fluffy_Pillow 88584.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(7)
0:34.895 build_a_shard J shadow_bolt Fluffy_Pillow 89458.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(7)
0:36.059 default H demonbolt Fluffy_Pillow 88622.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(8)
0:36.941 default G hand_of_guldan Fluffy_Pillow 87504.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(10), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(8)
0:37.826 default H demonbolt Fluffy_Pillow 88389.0/100000: 88% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(9), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(8)
0:38.715 build_a_shard J shadow_bolt Fluffy_Pillow 87278.0/100000: 87% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(8)
0:39.905 build_a_shard J shadow_bolt Fluffy_Pillow 86468.0/100000: 86% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, wild_imps(10), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(8)
0:41.103 build_a_shard J shadow_bolt Fluffy_Pillow 85666.0/100000: 86% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), overwhelming_power, archive_of_the_titans(9)
0:42.793 default G hand_of_guldan Fluffy_Pillow 85356.0/100000: 85% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), quick_navigation, archive_of_the_titans(9)
0:44.061 default E call_dreadstalkers Fluffy_Pillow 86624.0/100000: 87% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(9)
0:45.331 default H demonbolt Fluffy_Pillow 87894.0/100000: 88% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(10)
0:46.601 build_a_shard J shadow_bolt Fluffy_Pillow 87164.0/100000: 87% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(10)
0:48.291 default D summon_vilefiend Fluffy_Pillow 86854.0/100000: 87% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(10)
0:49.980 default G hand_of_guldan Fluffy_Pillow 88543.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(10)
0:51.246 build_a_shard J shadow_bolt Fluffy_Pillow 89809.0/100000: 90% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:52.936 build_a_shard J shadow_bolt Fluffy_Pillow 89499.0/100000: 89% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:54.625 build_a_shard J shadow_bolt Fluffy_Pillow 89188.0/100000: 89% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(11)
0:56.315 default G hand_of_guldan Fluffy_Pillow 88878.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(12)
0:57.584 default H demonbolt Fluffy_Pillow 90147.0/100000: 90% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, archive_of_the_titans(12)
0:58.853 default H demonbolt Fluffy_Pillow 89416.0/100000: 89% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation, archive_of_the_titans(12)
1:00.122 build_a_shard J shadow_bolt Fluffy_Pillow 88685.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation, archive_of_the_titans(13)
1:01.811 default G hand_of_guldan Fluffy_Pillow 88374.0/100000: 88% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:03.072 build_a_shard J shadow_bolt Fluffy_Pillow 89635.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:04.750 default E call_dreadstalkers Fluffy_Pillow 89313.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), archive_of_the_titans(13)
1:06.011 build_a_shard J shadow_bolt Fluffy_Pillow 90574.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(14)
1:07.692 default G hand_of_guldan Fluffy_Pillow 90255.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:08.944 build_a_shard J shadow_bolt Fluffy_Pillow 91507.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(14)
1:10.614 build_a_shard J shadow_bolt Fluffy_Pillow 91177.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:12.282 build_a_shard J shadow_bolt Fluffy_Pillow 90845.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:13.951 default G hand_of_guldan Fluffy_Pillow 90514.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(15)
1:15.203 build_a_shard J shadow_bolt Fluffy_Pillow 91766.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(16)
1:16.872 build_a_shard J shadow_bolt Fluffy_Pillow 91435.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(16)
1:18.540 default H demonbolt Fluffy_Pillow 91103.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(16)
1:19.791 default G hand_of_guldan Fluffy_Pillow 90354.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(16)
1:21.044 build_a_shard J shadow_bolt Fluffy_Pillow 91607.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(17)
1:22.703 build_a_shard J shadow_bolt Fluffy_Pillow 91266.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(4), archive_of_the_titans(17)
1:24.363 build_a_shard J shadow_bolt Fluffy_Pillow 90926.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(17)
1:26.023 build_a_shard J shadow_bolt Fluffy_Pillow 90586.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(4), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(18)
1:27.682 default G hand_of_guldan Fluffy_Pillow 90245.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(4), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(18)
1:28.928 default E call_dreadstalkers Fluffy_Pillow 91491.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(18)
1:30.173 default H demonbolt Fluffy_Pillow 92736.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(4), wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:31.419 default G hand_of_guldan Fluffy_Pillow 91982.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:32.666 default H demonbolt Fluffy_Pillow 93229.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:33.910 default H demonbolt Fluffy_Pillow 92473.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(19)
1:35.156 default D summon_vilefiend Fluffy_Pillow 91719.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
1:36.817 default G hand_of_guldan Fluffy_Pillow 93380.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:38.062 default F summon_demonic_tyrant Fluffy_Pillow 94625.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
1:39.720 default 8 potion Fluffy_Pillow 94283.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
1:39.720 default H demonbolt Fluffy_Pillow 94283.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:40.965 build_a_shard J shadow_bolt Fluffy_Pillow 93528.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:42.547 default G hand_of_guldan Fluffy_Pillow 93110.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:43.586 build_a_shard J shadow_bolt Fluffy_Pillow 94149.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20), battle_potion_of_intellect
1:44.977 build_a_shard J shadow_bolt Fluffy_Pillow 93540.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:46.374 build_a_shard J shadow_bolt Fluffy_Pillow 92937.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:47.783 build_a_shard J shadow_bolt Fluffy_Pillow 92346.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:49.201 default E call_dreadstalkers Fluffy_Pillow 91764.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20), battle_potion_of_intellect
1:50.633 build_a_shard J shadow_bolt Fluffy_Pillow 93196.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:52.172 default G hand_of_guldan Fluffy_Pillow 92735.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
1:53.338 build_a_shard J shadow_bolt Fluffy_Pillow 93901.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
1:54.901 default H demonbolt Fluffy_Pillow 93464.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(13), dreadstalkers(4), vilefiend, overwhelming_power(13), archive_of_the_titans(20), battle_potion_of_intellect
1:56.082 default G hand_of_guldan Fluffy_Pillow 92645.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
1:57.275 default H demonbolt Fluffy_Pillow 93838.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(10), archive_of_the_titans(20), battle_potion_of_intellect
1:58.476 default H demonbolt Fluffy_Pillow 93039.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(9), archive_of_the_titans(20), battle_potion_of_intellect
1:59.685 default G hand_of_guldan Fluffy_Pillow 92248.0/100000: 92% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
2:00.900 build_a_shard J shadow_bolt Fluffy_Pillow 93463.0/100000: 93% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
2:02.529 build_a_shard J shadow_bolt Fluffy_Pillow 93092.0/100000: 93% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(5), archive_of_the_titans(20), battle_potion_of_intellect
2:04.169 default G hand_of_guldan Fluffy_Pillow 92732.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(20), battle_potion_of_intellect
2:05.414 default H demonbolt Fluffy_Pillow 93977.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
2:06.665 default H demonbolt Fluffy_Pillow 93228.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation, overwhelming_power, archive_of_the_titans(20)
2:07.925 build_a_shard J shadow_bolt Fluffy_Pillow 92488.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:09.614 default G hand_of_guldan Fluffy_Pillow 92177.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), quick_navigation, archive_of_the_titans(20)
2:10.882 default E call_dreadstalkers Fluffy_Pillow 93445.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
2:12.151 default H demonbolt Fluffy_Pillow 94714.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:13.418 default G hand_of_guldan Fluffy_Pillow 93981.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:14.689 build_a_shard J shadow_bolt Fluffy_Pillow 95252.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:16.377 build_a_shard J shadow_bolt Fluffy_Pillow 94940.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:18.067 build_a_shard J shadow_bolt Fluffy_Pillow 94630.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:19.757 build_a_shard J shadow_bolt Fluffy_Pillow 94320.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:21.436 build_a_shard J shadow_bolt Fluffy_Pillow 93999.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:23.116 default D summon_vilefiend Fluffy_Pillow 93679.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:24.794 default G hand_of_guldan Fluffy_Pillow 95357.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
2:26.056 default H demonbolt Fluffy_Pillow 96619.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps, vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:27.308 default H demonbolt Fluffy_Pillow 95871.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:28.561 default G hand_of_guldan Fluffy_Pillow 95124.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:29.812 build_a_shard J shadow_bolt Fluffy_Pillow 96375.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:31.483 default E call_dreadstalkers Fluffy_Pillow 96046.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:32.729 build_a_shard J shadow_bolt Fluffy_Pillow 97292.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:34.389 default G hand_of_guldan Fluffy_Pillow 96952.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:35.634 build_a_shard J shadow_bolt Fluffy_Pillow 98197.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:37.292 build_a_shard J shadow_bolt Fluffy_Pillow 97855.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:38.952 build_a_shard J shadow_bolt Fluffy_Pillow 97515.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:40.611 build_a_shard J shadow_bolt Fluffy_Pillow 97174.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:42.192 build_a_shard J shadow_bolt Fluffy_Pillow 96755.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:43.776 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96339.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:44.964 build_a_shard J shadow_bolt Fluffy_Pillow 97527.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation_final, archive_of_the_titans(20)
2:46.545 build_a_shard J shadow_bolt Fluffy_Pillow 97108.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation_final, archive_of_the_titans(20)
2:48.128 build_a_shard J shadow_bolt Fluffy_Pillow 96691.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:49.711 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96274.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:50.898 build_a_shard J shadow_bolt Fluffy_Pillow 97461.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(20)
2:52.598 nether_portal_building W call_dreadstalkers Fluffy_Pillow 97161.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(20)
2:53.876 build_a_shard J shadow_bolt Fluffy_Pillow 98439.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(7), dreadstalkers(2), archive_of_the_titans(20)
2:55.576 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:57.264 build_a_shard J shadow_bolt Fluffy_Pillow 97692.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:58.956 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97384.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:00.219 build_a_shard J shadow_bolt Fluffy_Pillow 98647.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:01.900 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:03.579 build_a_shard J shadow_bolt Fluffy_Pillow 97685.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:05.249 nether_portal_building V nether_portal Fluffy_Pillow 97355.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
3:06.495 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98601.0/100000: 99% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons, quick_navigation(4), archive_of_the_titans(20)
3:07.741 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99847.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(2), quick_navigation_final, archive_of_the_titans(20)
3:08.928 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation_final, archive_of_the_titans(20)
3:10.115 nether_portal_active N summon_vilefiend Fluffy_Pillow 99187.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(3), quick_navigation_final, archive_of_the_titans(20)
3:11.698 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), quick_navigation_final, archive_of_the_titans(20)
3:13.281 nether_portal_active O call_dreadstalkers Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(6), vilefiend, portal_summons(4), quick_navigation_final, archive_of_the_titans(20)
3:14.469 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99193.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation_final, archive_of_the_titans(20)
3:15.656 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, portal_summons(6), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
3:17.039 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
3:17.039 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse
3:17.039 nether_portal_active T demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse
3:17.927 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96893.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse
3:18.869 build_a_shard J shadow_bolt Fluffy_Pillow 97835.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse
3:20.132 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97098.0/100000: 97% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse
3:21.089 build_a_shard J shadow_bolt Fluffy_Pillow 98055.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.336 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97302.0/100000: 97% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.270 build_a_shard J shadow_bolt Fluffy_Pillow 98236.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.517 build_a_shard J shadow_bolt Fluffy_Pillow 97483.0/100000: 97% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(2)
3:25.769 build_a_shard J shadow_bolt Fluffy_Pillow 96735.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.991 default G hand_of_guldan Fluffy_Pillow 95957.0/100000: 96% mana | 3.0/5: 60% soul_shard berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.915 build_a_shard J shadow_bolt Fluffy_Pillow 96881.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(3)
3:29.336 build_a_shard J shadow_bolt Fluffy_Pillow 96302.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.733 build_a_shard J shadow_bolt Fluffy_Pillow 95699.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.137 default H demonbolt Fluffy_Pillow 95103.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse(4)
3:33.201 default E call_dreadstalkers Fluffy_Pillow 94167.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.321 default G hand_of_guldan Fluffy_Pillow 95287.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.367 build_a_shard J shadow_bolt Fluffy_Pillow 96333.0/100000: 96% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.637 build_a_shard J shadow_bolt Fluffy_Pillow 95603.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(5)
3:37.913 default G hand_of_guldan Fluffy_Pillow 94879.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
3:39.017 default H demonbolt Fluffy_Pillow 95983.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
3:40.133 build_a_shard J shadow_bolt Fluffy_Pillow 95099.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
3:41.629 default G hand_of_guldan Fluffy_Pillow 94595.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
3:42.757 default H demonbolt Fluffy_Pillow 95723.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
3:43.893 default H demonbolt Fluffy_Pillow 94859.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
3:45.037 default G hand_of_guldan Fluffy_Pillow 94003.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
3:46.192 default H demonbolt Fluffy_Pillow 95158.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
3:47.347 default G hand_of_guldan Fluffy_Pillow 94313.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
3:48.509 default H demonbolt Fluffy_Pillow 95475.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(20)
3:49.678 build_a_shard J shadow_bolt Fluffy_Pillow 94644.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(8), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
3:51.243 build_a_shard J shadow_bolt Fluffy_Pillow 94209.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(10), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
3:52.827 build_a_shard J shadow_bolt Fluffy_Pillow 93793.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(4), overwhelming_power(8), archive_of_the_titans(20)
3:54.410 default E call_dreadstalkers Fluffy_Pillow 93376.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
3:55.558 build_a_shard J shadow_bolt Fluffy_Pillow 94524.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
3:57.096 default D summon_vilefiend Fluffy_Pillow 94062.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
3:58.652 default G hand_of_guldan Fluffy_Pillow 95618.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
3:59.826 default H demonbolt Fluffy_Pillow 96792.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
4:01.006 default G hand_of_guldan Fluffy_Pillow 95972.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:02.194 build_a_shard J shadow_bolt Fluffy_Pillow 97160.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:03.779 build_a_shard J shadow_bolt Fluffy_Pillow 96745.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:05.364 build_a_shard J shadow_bolt Fluffy_Pillow 96330.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:07.063 default G hand_of_guldan Fluffy_Pillow 96029.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), vilefiend, archive_of_the_titans(20)
4:08.341 default H demonbolt Fluffy_Pillow 97307.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(20)
4:09.618 default H demonbolt Fluffy_Pillow 96584.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, archive_of_the_titans(20)
4:10.895 build_a_shard J shadow_bolt Fluffy_Pillow 95861.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(20)
4:12.595 default G hand_of_guldan Fluffy_Pillow 95561.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, archive_of_the_titans(20)
4:13.872 build_a_shard J shadow_bolt Fluffy_Pillow 96838.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
4:15.562 default E call_dreadstalkers Fluffy_Pillow 96528.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:16.831 build_a_shard J shadow_bolt Fluffy_Pillow 97797.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:18.521 default G hand_of_guldan Fluffy_Pillow 97487.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:19.790 build_a_shard J shadow_bolt Fluffy_Pillow 98756.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:21.253 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
4:22.724 build_a_shard J shadow_bolt Fluffy_Pillow 97475.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:24.204 default G hand_of_guldan Fluffy_Pillow 96955.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
4:25.326 build_a_shard J shadow_bolt Fluffy_Pillow 98077.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
4:26.831 build_a_shard J shadow_bolt Fluffy_Pillow 97582.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
4:28.286 build_a_shard J shadow_bolt Fluffy_Pillow 97037.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(7), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
4:29.758 default G hand_of_guldan Fluffy_Pillow 96509.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:30.869 build_a_shard J shadow_bolt Fluffy_Pillow 97620.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
4:32.356 build_a_shard J shadow_bolt Fluffy_Pillow 97107.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
4:33.861 build_a_shard J shadow_bolt Fluffy_Pillow 96612.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
4:35.365 default H demonbolt Fluffy_Pillow 96116.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
4:36.506 default G hand_of_guldan Fluffy_Pillow 95257.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
4:37.653 default H demonbolt Fluffy_Pillow 96404.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
4:38.808 default E call_dreadstalkers Fluffy_Pillow 95559.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
4:39.970 default G hand_of_guldan Fluffy_Pillow 96721.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
4:41.057 build_a_shard J shadow_bolt Fluffy_Pillow 97808.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
4:42.520 build_a_shard J shadow_bolt Fluffy_Pillow 97271.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
4:43.991 default D summon_vilefiend Fluffy_Pillow 96742.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20)
4:45.471 build_a_shard J shadow_bolt Fluffy_Pillow 98222.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20)
4:46.966 build_a_shard J shadow_bolt Fluffy_Pillow 97717.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
4:48.406 default F summon_demonic_tyrant Fluffy_Pillow 97157.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
4:49.863 default G hand_of_guldan Fluffy_Pillow 96614.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
4:50.962 build_a_shard J shadow_bolt Fluffy_Pillow 97713.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps, dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20)
4:52.434 build_a_shard J shadow_bolt Fluffy_Pillow 97185.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
4:53.922 build_a_shard J shadow_bolt Fluffy_Pillow 96673.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
4:55.419 build_a_shard J shadow_bolt Fluffy_Pillow 96170.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
4:56.931 build_a_shard J shadow_bolt Fluffy_Pillow 95682.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
4:58.452 default G hand_of_guldan Fluffy_Pillow 95203.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(5), archive_of_the_titans(20)
4:59.690 default E call_dreadstalkers Fluffy_Pillow 96441.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, overwhelming_power(4), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_ID_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DL_ID_Imp : 17191 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17191.3 17191.3 15.4 / 0.089% 2194.7 / 12.8% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.4 960.9 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Dreadlash (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DL_ID_Imp 17191
Demonbolt 1331 7.8% 46.9 5.83sec 8517 7491 Direct 47.7 7115 14232 8369 17.6%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.88 47.71 0.00 0.00 1.1370 0.0000 399324.93 399324.93 0.00 7491.04 7491.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.30 82.38% 7115.14 6520 8308 7116.52 6893 7341 279647 279647 0.00
crit 8.41 17.62% 14232.42 13040 16616 14230.93 0 16616 119678 119678 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1098 6.4% 62.8 4.73sec 5239 4744 Direct 62.7 4464 8923 5250 17.6%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.83 62.69 0.00 0.00 1.1042 0.0000 329158.81 329158.81 0.00 4744.49 4744.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.64 82.36% 4463.76 1634 5979 4457.84 4006 4848 230499 230499 0.00
crit 11.06 17.64% 8922.78 3267 11958 8910.73 0 11012 98660 98660 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 140 (200) 0.8% (1.2%) 7.3 37.12sec 8260 0 Direct 7.3 4925 9849 5775 17.3%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.28 7.28 0.00 0.00 0.0000 0.0000 42050.89 42050.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.02 82.73% 4924.62 4925 4925 4922.65 0 4925 29668 29668 0.00
crit 1.26 17.27% 9849.24 9849 9849 7079.08 0 9849 12383 12383 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 37.12sec 2485 0 Direct 7.3 2111 4221 2485 17.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.28 7.28 0.00 0.00 0.0000 0.0000 18096.11 18096.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.99 82.25% 2110.55 2111 2111 2109.71 0 2111 12641 12641 0.00
crit 1.29 17.75% 4221.10 4221 4221 3070.20 0 4221 5456 5456 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1317 7.7% 94.1 3.13sec 4197 2812 Direct 93.4 3593 7186 4227 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.09 93.41 0.00 0.00 1.4926 0.0000 394887.39 394887.39 0.00 2811.85 2811.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.92 82.34% 3592.90 3335 4297 3593.49 3550 3648 276353 276353 0.00
crit 16.49 17.66% 7186.41 6670 8595 7187.12 6936 7680 118535 118535 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 288 1.7% 7.3 37.24sec 11858 0 Direct 7.2 10240 20481 12035 17.5%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.27 7.17 0.00 0.00 0.0000 0.0000 86256.10 86256.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.91 82.48% 10240.44 10240 10240 10232.25 0 10240 60539 60539 0.00
crit 1.26 17.52% 20480.88 20481 20481 14921.26 0 20481 25717 25717 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3137 / 3137
Firebolt 3137 18.3% 103.8 2.89sec 9059 6924 Direct 103.0 7759 15521 9131 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.78 102.96 0.00 0.00 1.3083 0.0000 940113.80 940113.80 0.00 6924.46 6924.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.76 82.32% 7758.88 7027 9401 7759.85 7621 7895 657611 657611 0.00
crit 18.20 17.68% 15521.13 14053 18802 15521.18 14481 16897 282503 282503 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - vicious_hellhound 1042 / 158
Demon Fangs 647 0.6% 10.5 12.80sec 2787 2788 Direct 10.5 2372 4746 2788 17.5%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.46 10.46 0.00 0.00 1.0000 0.0000 29147.46 29147.46 0.00 2787.63 2787.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.63 82.50% 2372.13 2026 2711 2366.69 0 2711 20464 20464 0.00
crit 1.83 17.50% 4745.68 4053 5422 3726.36 0 5422 8683 8683 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 396 0.3% 91.5 1.41sec 194 319 Direct 91.5 165 331 194 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.47 91.47 0.00 0.00 0.6091 0.0000 17779.31 25417.67 30.05 319.09 319.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.35 82.38% 165.23 141 188 164.91 142 185 12451 17800 30.05
crit 16.12 17.62% 330.59 281 376 329.18 0 376 5329 7618 29.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - urzul 1299 / 196
Many Faced Bite 489 0.4% 10.5 12.44sec 2093 2093 Direct 10.5 1778 3554 2093 17.8%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.46 10.46 0.00 0.00 1.0000 0.0000 21903.72 31313.99 30.05 2093.45 2093.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.60 82.24% 1777.99 1519 2032 1772.91 0 1983 15299 21871 29.98
crit 1.86 17.76% 3554.16 3037 4064 2804.18 0 4064 6605 9443 23.74
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 810 0.7% 46.6 2.76sec 776 649 Direct 46.6 659 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.57 46.57 0.00 0.00 1.1949 0.0000 36132.65 51655.97 30.05 649.30 649.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.36 82.37% 659.49 562 753 658.53 569 738 25298 36166 30.05
crit 8.21 17.63% 1319.22 1125 1505 1300.14 0 1505 10835 15490 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3123 / 1559
Bile Spit 1098 3.2% 6.8 47.19sec 23981 0 Direct 6.8 8824 17650 10424 18.1%  
Periodic 33.4 2777 0 2777 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.42 33.42 0.0000 2.0000 163983.43 163983.43 0.00 2453.04 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.59 81.88% 8824.06 8474 10104 8823.91 8474 9560 49329 49329 0.00
crit 1.24 18.12% 17650.48 16947 20207 13113.98 0 20207 21831 21831 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.4 100.00% 2777.04 2502 3310 2777.46 2622 2868 92823 92823 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 732 2.1% 30.1 9.82sec 3646 3646 Direct 30.1 3100 6198 3646 17.6%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.08 30.08 0.00 0.00 1.0000 0.0000 109671.46 156788.52 30.05 3646.11 3646.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.78 82.38% 3100.36 2737 3621 3101.11 2942 3232 76829 109836 30.05
crit 5.30 17.62% 6198.29 5474 7243 6166.73 0 7243 32842 46952 29.90
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1293 3.8% 107.8 2.71sec 1794 1338 Direct 107.8 1526 3051 1794 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.78 107.78 0.00 0.00 1.3411 0.0000 193404.62 276495.13 30.05 1338.09 1338.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.79 82.38% 1525.66 1337 1775 1526.03 1459 1564 135470 193671 30.05
crit 18.99 17.62% 3051.46 2673 3550 3052.23 2842 3331 57934 82824 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3641 / 2402
Dreadbite 1335 5.1% 29.0 21.05sec 9088 0 Direct 29.0 7718 15441 9088 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.05 29.05 0.00 0.00 0.0000 0.0000 263998.60 263998.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.90 82.26% 7718.48 7139 9517 7718.64 7447 7974 184445 184445 0.00
crit 5.15 17.74% 15441.02 14278 19033 15377.04 0 19033 79553 79553 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.9% 311.9 1.90sec 1462 1106 Direct 311.9 1243 2485 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.90 311.90 0.00 0.00 1.3224 0.0000 456104.50 652056.15 30.05 1105.84 1105.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.74 82.31% 1242.61 1105 1473 1242.77 1220 1264 319021 456079 30.05
crit 55.16 17.69% 2485.16 2211 2947 2485.46 2392 2617 137083 195977 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - void_terror 1783 / 272
Double Breath 0 (148) 0.0% (0.9%) 0.0 0.00sec 0 7313

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7313.13 7313.13
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 485 0.4% 7.9 17.23sec 2790 0 Direct 7.9 2366 4737 2790 17.9%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.87 7.87 0.00 0.00 0.0000 0.0000 21968.26 21968.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.46 82.10% 2365.85 2026 2711 2357.36 0 2711 15293 15293 0.00
crit 1.41 17.90% 4736.72 4053 5422 3435.15 0 5422 6675 6675 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 484 0.4% 7.9 17.23sec 2782 0 Direct 7.9 2365 4740 2782 17.5%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.87 7.87 0.00 0.00 0.0000 0.0000 21903.21 21903.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.49 82.46% 2365.48 2026 2711 2357.20 0 2711 15358 15358 0.00
crit 1.38 17.54% 4740.33 4053 5422 3380.92 0 5422 6545 6545 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 814 0.7% 47.2 2.72sec 776 650 Direct 47.2 660 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.23 47.23 0.00 0.00 1.1938 0.0000 36664.51 52416.32 30.05 650.32 650.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.86 82.30% 659.53 562 753 658.71 569 747 25633 36645 30.05
crit 8.36 17.70% 1319.45 1125 1505 1306.83 0 1505 11032 15771 29.79
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wild_imp 3110 / 3041
Fel Firebolt 3110 17.7% 1216.1 0.24sec 750 507 Direct 1211.2 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1216.11 1211.21 0.00 0.00 1.4775 0.0000 911676.05 911676.05 0.00 507.38 507.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 997.09 82.32% 639.66 569 761 639.73 630 650 637795 637795 0.00
crit 214.12 17.68% 1279.10 1138 1523 1279.25 1248 1322 273881 273881 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - bilescourge 3779 / 572
Toxic Bile 3779 3.3% 60.5 2.06sec 2803 2956 Direct 60.5 2382 4764 2805 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.50 60.47 0.00 0.00 0.9483 0.0000 169599.94 169599.94 0.00 2956.09 2956.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.76 82.27% 2382.43 2026 2711 2378.03 0 2663 118538 118538 0.00
crit 10.72 17.73% 4763.70 4053 5422 4708.74 0 5422 51062 51062 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - demonic_tyrant 4671 / 822
Demonfire 4671 4.8% 37.7 6.88sec 6534 4899 Direct 37.6 5561 11127 6547 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.66 37.59 0.00 0.00 1.3337 0.0000 246087.23 246087.23 0.00 4899.01 4899.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.93 82.29% 5560.74 5029 5917 5564.15 5471 5677 171998 171998 0.00
crit 6.66 17.71% 11127.19 10059 11834 11123.04 0 11834 74089 74089 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - shivarra 1891 / 289
melee 812 0.7% 47.4 2.83sec 775 648 Direct 47.4 659 1319 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.37 47.37 0.00 0.00 1.1961 0.0000 36725.32 52503.26 30.05 648.12 648.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.05 82.44% 659.46 562 753 658.56 570 739 25755 36819 30.05
crit 8.32 17.56% 1318.62 1125 1505 1300.21 0 1505 10971 15684 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 406 0.4% 47.4 2.83sec 388 306 Direct 47.4 330 660 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.37 47.37 0.00 0.00 1.2658 0.0000 18365.05 26255.04 30.05 306.26 306.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.05 82.43% 329.70 281 376 329.23 282 369 12875 18406 30.05
crit 8.32 17.57% 659.60 562 753 648.75 0 753 5490 7849 29.59
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (103) 0.0% (0.6%) 0.0 0.00sec 0 3935

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3935.44 3935.44
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.8 18.39sec 984 0 Direct 7.8 835 1670 984 17.8%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 7.76 0.00 0.00 0.0000 0.0000 7635.81 10916.30 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.16% 835.47 717 959 831.46 0 944 5325 7612 29.92
crit 1.38 17.84% 1669.71 1434 1919 1186.56 0 1919 2311 3304 21.35
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 168 0.1% 7.8 18.39sec 981 0 Direct 7.8 835 1672 981 17.4%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 7.76 0.00 0.00 0.0000 0.0000 7606.48 10874.37 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 82.64% 835.19 717 959 831.98 0 959 5354 7654 29.94
crit 1.35 17.36% 1672.31 1434 1919 1181.28 0 1919 2252 3220 21.23
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 168 0.1% 7.8 18.39sec 985 0 Direct 7.8 836 1669 985 18.0%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 7.76 0.00 0.00 0.0000 0.0000 7643.55 10927.37 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 82.03% 835.51 717 959 831.18 0 937 5317 7601 29.89
crit 1.39 17.97% 1669.34 1434 1919 1204.94 0 1919 2327 3326 21.70
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.1% 7.8 18.39sec 985 0 Direct 7.8 835 1671 985 17.9%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 7.76 0.00 0.00 0.0000 0.0000 7641.38 10924.27 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 82.08% 835.35 717 959 830.05 0 959 5319 7604 29.87
crit 1.39 17.92% 1670.81 1434 1919 1194.11 0 1919 2322 3320 21.49
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - illidari_satyr 1241 / 188
melee 407 0.4% 47.1 2.72sec 387 324 Direct 47.1 330 659 387 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.09 47.09 0.00 0.00 1.1963 0.0000 18242.22 26079.44 30.05 323.84 323.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.82 82.44% 329.61 281 376 329.31 285 369 12795 18292 30.05
crit 8.27 17.56% 658.82 562 753 647.66 0 745 5447 7787 29.57
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 204 0.2% 47.1 2.72sec 194 153 Direct 47.1 165 330 194 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.09 47.09 0.00 0.00 1.2662 0.0000 9130.15 13052.65 30.05 153.14 153.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.77 82.33% 164.79 141 188 164.64 142 185 6389 9133 30.05
crit 8.32 17.67% 329.52 281 376 325.64 0 376 2742 3919 29.71
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 630 0.6% 10.2 12.81sec 2792 2792 Direct 10.2 2373 4746 2792 17.6%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.20 10.20 0.00 0.00 1.0000 0.0000 28481.08 28481.08 0.00 2791.99 2791.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.40 82.36% 2373.34 2026 2711 2368.66 0 2711 19940 19940 0.00
crit 1.80 17.64% 4745.90 4053 5422 3710.02 0 5422 8541 8541 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1278 / 195
Fel Bite 461 0.4% 10.0 13.24sec 2088 2088 Direct 10.0 1779 3559 2088 17.3%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.99 9.99 0.00 0.00 1.0000 0.0000 20864.07 29827.69 30.05 2087.87 2087.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.26 82.67% 1779.26 1519 2032 1775.87 0 1983 14700 21015 29.98
crit 1.73 17.33% 3558.80 3037 4064 2751.02 0 4064 6164 8813 23.23
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 817 0.7% 47.3 2.72sec 776 651 Direct 47.3 659 1320 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.29 47.29 0.00 0.00 1.1923 0.0000 36708.13 52478.68 30.05 651.06 651.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.92 82.31% 659.47 562 753 658.71 0 739 25669 36697 30.04
crit 8.36 17.69% 1319.67 1125 1505 1299.88 0 1505 11039 15781 29.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - wrathguard 1702 / 258
melee 823 0.7% 47.7 2.70sec 776 650 Direct 47.7 659 1320 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.69 47.69 0.00 0.00 1.1940 0.0000 37018.87 52922.93 30.05 650.07 650.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.26 82.33% 659.48 562 753 658.64 570 737 25894 37019 30.05
crit 8.43 17.67% 1319.83 1125 1505 1301.52 0 1505 11125 15904 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 412 0.4% 47.7 2.70sec 388 307 Direct 47.7 330 660 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.69 47.69 0.00 0.00 1.2634 0.0000 18501.76 26450.49 30.05 307.05 307.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.29 82.37% 329.76 281 376 329.32 282 371 12955 18520 30.05
crit 8.41 17.63% 659.74 562 753 651.08 0 753 5547 7930 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 466 0.4% 10.1 13.03sec 2093 2093 Direct 10.1 1779 3556 2093 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.10 10.10 0.00 0.00 1.0000 0.0000 21134.00 30213.59 30.05 2092.68 2092.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.32 82.35% 1778.89 1519 2032 1774.61 0 1993 14795 21151 29.98
crit 1.78 17.65% 3555.68 3037 4064 2776.79 0 4064 6339 9062 23.48
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4533 / 400
melee 3027 1.5% 21.4 1.50sec 3680 3081 Direct 21.4 3122 6244 3680 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.41 21.41 0.00 0.00 1.1944 0.0000 78793.95 112645.42 30.05 3081.38 3081.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.58 82.12% 3121.88 2665 3566 3109.79 2696 3502 54887 78467 30.05
crit 3.83 17.88% 6244.06 5330 7131 6025.31 0 7131 23907 34178 29.13
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1505 0.8% 21.4 1.50sec 1833 1451 Direct 21.4 1561 3121 1833 17.4%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.41 21.41 0.00 0.00 1.2631 0.0000 39246.37 56107.39 30.05 1451.31 1451.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.68 82.56% 1561.08 1333 1783 1554.85 1347 1751 27594 39449 30.05
crit 3.73 17.44% 3120.65 2665 3566 2959.15 0 3566 11652 16659 28.57
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - eye_of_guldan 975 / 83
Eye of Gul'dan 975 0.5% 28.5 4.87sec 863 1131 Periodic 61.7 399 0 399 0.0% 60.4%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.51 0.00 61.67 61.67 0.7636 2.9389 24615.28 24615.28 0.00 121.25 1130.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.7 100.00% 399.16 182 484 397.32 0 430 24615 24615 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DL_ID_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.99sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.05sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2034 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DL_ID_Imp
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2384 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.54sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5087 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 17.8 14.73sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.19sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5526 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.55% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.6 23.2sec 10.2sec 52.11% 83.84% 15.6(15.6) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.11%

Trigger Attempt Success

  • trigger_pct:19.99%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.5 32.1 11.7sec 5.0sec 40.23% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.46%
  • demonic_core_2:15.87%
  • demonic_core_3:5.45%
  • demonic_core_4:2.44%

Trigger Attempt Success

  • trigger_pct:23.55%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.6 26.8sec 10.2sec 65.98% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.60%
  • dreadstalkers_4:6.38%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 156.3sec 2.7sec 1.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.03%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.96% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 67.4sec 37.0sec 43.73% 0.00% 2.9(40.7) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.29%
  • overwhelming_power_2:1.32%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.39%
  • overwhelming_power_5:1.42%
  • overwhelming_power_6:1.46%
  • overwhelming_power_7:1.50%
  • overwhelming_power_8:1.54%
  • overwhelming_power_9:1.58%
  • overwhelming_power_10:1.62%
  • overwhelming_power_11:1.67%
  • overwhelming_power_12:1.71%
  • overwhelming_power_13:1.76%
  • overwhelming_power_14:1.80%
  • overwhelming_power_15:1.86%
  • overwhelming_power_16:1.91%
  • overwhelming_power_17:1.96%
  • overwhelming_power_18:2.02%
  • overwhelming_power_19:2.08%
  • overwhelming_power_20:2.14%
  • overwhelming_power_21:2.19%
  • overwhelming_power_22:2.26%
  • overwhelming_power_23:2.33%
  • overwhelming_power_24:2.39%
  • overwhelming_power_25:1.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.3 182.9sec 14.5sec 19.52% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.77%
  • portal_summons_3:1.25%
  • portal_summons_4:1.54%
  • portal_summons_5:1.85%
  • portal_summons_6:1.84%
  • portal_summons_7:3.97%
  • portal_summons_8:5.85%
  • portal_summons_9:0.75%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 161.4sec 87.1sec 1.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.4sec 10.4sec 67.60% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.65%
  • quick_navigation_2:17.14%
  • quick_navigation_3:16.64%
  • quick_navigation_4:16.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.4sec 52.4sec 17.46% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.8sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.96% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.96%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.0 132.2sec 0.0sec 97.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.40%
  • wild_imps_2:2.05%
  • wild_imps_3:10.36%
  • wild_imps_4:20.98%
  • wild_imps_5:8.09%
  • wild_imps_6:14.85%
  • wild_imps_7:18.54%
  • wild_imps_8:5.09%
  • wild_imps_9:3.54%
  • wild_imps_10:3.97%
  • wild_imps_11:4.19%
  • wild_imps_12:1.69%
  • wild_imps_13:1.20%
  • wild_imps_14:1.25%
  • wild_imps_15:0.34%
  • wild_imps_16:0.16%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DL_ID_Imp
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 14.0sec
one_shard_hog 9.0 21.9sec
two_shard_hog 4.2 48.8sec
three_shard_hog 49.7 5.7sec
portal_summon 15.3 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DL_ID_Imp
call_dreadstalkers Soul Shard 14.6 16.9 1.2 1.2 0.0
demonbolt Mana 47.9 95766.1 2000.0 2042.6 4.2
hand_of_guldan Soul Shard 62.8 166.4 2.6 2.6 1978.4
shadow_bolt Mana 94.1 188185.9 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7163.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4151.0 40.0 40.0 226.5
pet - wild_imp
fel_firebolt Energy 1216.1 18623.1 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.88 95.63 (50.41%) 2.00 0.13 0.14%
shadow_bolt Soul Shard 94.09 94.09 (49.59%) 1.00 0.00 0.00%
mana_regen Mana 555.83 288263.84 (100.00%) 518.62 11185.21 3.74%
pet - imp
energy_regen Energy 425.22 3980.11 (100.00%) 9.36 22.74 0.57%
pet - bilescourge
energy_regen Energy 15.79 0.00 (0.00%) 0.00 219.14 100.00%
pet - demonic_tyrant
energy_regen Energy 37.67 0.00 (0.00%) 0.00 760.24 100.00%
pet - bilescourge
energy_regen Energy 14.14 0.00 (0.00%) 0.00 196.01 100.00%
pet - bilescourge
energy_regen Energy 13.19 0.00 (0.00%) 0.00 183.80 100.00%
pet - bilescourge
energy_regen Energy 9.00 0.00 (0.00%) 0.00 125.01 100.00%
pet - bilescourge
energy_regen Energy 6.79 0.00 (0.00%) 0.00 95.05 100.00%
pet - bilescourge
energy_regen Energy 0.20 0.00 (0.00%) 0.00 2.73 100.00%
Resource RPS-Gain RPS-Loss
Mana 960.92 970.42
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97181.27 92317.00 100000.00
Soul Shard 2.58 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DL_ID_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DL_ID_Imp Damage Per Second
Count 4999
Mean 17191.28
Minimum 15701.38
Maximum 19439.61
Spread ( max - min ) 3738.23
Range [ ( max - min ) / 2 * 100% ] 10.87%
Standard Deviation 553.8557
5th Percentile 16350.91
95th Percentile 18194.06
( 95th Percentile - 5th Percentile ) 1843.15
Mean Distribution
Standard Deviation 7.8335
95.00% Confidence Intervall ( 17175.92 - 17206.63 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3988
0.1 Scale Factor Error with Delta=300 2619
0.05 Scale Factor Error with Delta=300 10475
0.01 Scale Factor Error with Delta=300 261865
Priority Target DPS
Sample Data DL_ID_Imp Priority Target Damage Per Second
Count 4999
Mean 17191.28
Minimum 15701.38
Maximum 19439.61
Spread ( max - min ) 3738.23
Range [ ( max - min ) / 2 * 100% ] 10.87%
Standard Deviation 553.8557
5th Percentile 16350.91
95th Percentile 18194.06
( 95th Percentile - 5th Percentile ) 1843.15
Mean Distribution
Standard Deviation 7.8335
95.00% Confidence Intervall ( 17175.92 - 17206.63 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3988
0.1 Scale Factor Error with Delta=300 2619
0.05 Scale Factor Error with Delta=300 10475
0.01 Scale Factor Error with Delta=300 261865
DPS(e)
Sample Data DL_ID_Imp Damage Per Second (Effective)
Count 4999
Mean 17191.28
Minimum 15701.38
Maximum 19439.61
Spread ( max - min ) 3738.23
Range [ ( max - min ) / 2 * 100% ] 10.87%
Damage
Sample Data DL_ID_Imp Damage
Count 4999
Mean 1269774.22
Minimum 913369.89
Maximum 1678849.87
Spread ( max - min ) 765479.99
Range [ ( max - min ) / 2 * 100% ] 30.14%
DTPS
Sample Data DL_ID_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DL_ID_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DL_ID_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DL_ID_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DL_ID_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DL_ID_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DL_ID_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DL_ID_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.15 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.82 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.60 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.41 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.06 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.02 call_dreadstalkers
X 0.55 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.93 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJEGHJGJHGHHGJJGHHGJJJJEJDGJJGJHGHJJJEGJHGJJGJJJGJJJHGEHHDGJF8JGJJJJEGJJHGHGHHGHGHHJEGJJGHJHDGHGHJJJEGJJGHJJJYJJJYWJJJJVQQTQTQTNQR9ATOQTQTQJJJGJHGHHJGJEHGHGHHGJJGHHJGDEJJJGJJJGHHGJJJEGHJGJJJGJJHJGEHHGDFHGHJGJJJJEG

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DL_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active N summon_vilefiend Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.585 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:03.893 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:04.876 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:06.177 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect
0:07.149 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98977.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect
0:08.441 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect
0:08.441 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.441 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.528 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97091.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.345 build_a_shard J shadow_bolt Fluffy_Pillow 97908.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.433 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96996.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.248 build_a_shard J shadow_bolt Fluffy_Pillow 97811.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.331 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96894.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.114 build_a_shard J shadow_bolt Fluffy_Pillow 97677.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.156 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96719.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.938 build_a_shard J shadow_bolt Fluffy_Pillow 97501.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.978 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96541.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.739 build_a_shard J shadow_bolt Fluffy_Pillow 97302.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.747 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96310.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.620 build_a_shard J shadow_bolt Fluffy_Pillow 97183.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.780 build_a_shard J shadow_bolt Fluffy_Pillow 96343.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.905 build_a_shard J shadow_bolt Fluffy_Pillow 95468.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.031 build_a_shard J shadow_bolt Fluffy_Pillow 94594.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.157 default E call_dreadstalkers Fluffy_Pillow 93720.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.003 default G hand_of_guldan Fluffy_Pillow 94566.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.822 default H demonbolt Fluffy_Pillow 95385.0/100000: 95% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.644 build_a_shard J shadow_bolt Fluffy_Pillow 94207.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(4), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.739 default G hand_of_guldan Fluffy_Pillow 93302.0/100000: 93% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.493 build_a_shard J shadow_bolt Fluffy_Pillow 94056.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(6)
0:29.562 default H demonbolt Fluffy_Pillow 93125.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(6)
0:30.367 default G hand_of_guldan Fluffy_Pillow 91930.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(7)
0:31.176 default H demonbolt Fluffy_Pillow 92739.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(7)
0:31.991 default H demonbolt Fluffy_Pillow 91554.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(7)
0:32.809 default G hand_of_guldan Fluffy_Pillow 90372.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(7)
0:33.630 build_a_shard J shadow_bolt Fluffy_Pillow 91193.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(7)
0:34.726 build_a_shard J shadow_bolt Fluffy_Pillow 90289.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(7)
0:35.831 default G hand_of_guldan Fluffy_Pillow 89394.0/100000: 89% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(8)
0:36.665 default H demonbolt Fluffy_Pillow 90228.0/100000: 90% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(8)
0:37.502 default H demonbolt Fluffy_Pillow 89065.0/100000: 89% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(8)
0:38.346 default G hand_of_guldan Fluffy_Pillow 87909.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), overwhelming_power(14), archive_of_the_titans(8)
0:39.249 build_a_shard J shadow_bolt Fluffy_Pillow 88812.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, wild_imps(7), overwhelming_power(13), archive_of_the_titans(8)
0:40.462 build_a_shard J shadow_bolt Fluffy_Pillow 88025.0/100000: 88% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, wild_imps(7), overwhelming_power(12), archive_of_the_titans(9)
0:41.682 build_a_shard J shadow_bolt Fluffy_Pillow 87245.0/100000: 87% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(11), archive_of_the_titans(9)
0:43.264 build_a_shard J shadow_bolt Fluffy_Pillow 86827.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(9), archive_of_the_titans(9)
0:44.865 default E call_dreadstalkers Fluffy_Pillow 86428.0/100000: 86% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(5), quick_navigation, overwhelming_power(8), archive_of_the_titans(9)
0:46.073 build_a_shard J shadow_bolt Fluffy_Pillow 87636.0/100000: 88% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(10)
0:47.703 default D summon_vilefiend Fluffy_Pillow 87266.0/100000: 87% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(5), archive_of_the_titans(10)
0:49.343 default G hand_of_guldan Fluffy_Pillow 88906.0/100000: 89% mana | 4.0/5: 80% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(10)
0:50.591 build_a_shard J shadow_bolt Fluffy_Pillow 90154.0/100000: 90% mana | 1.0/5: 20% soul_shard wild_imps, dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(2), archive_of_the_titans(11)
0:52.251 build_a_shard J shadow_bolt Fluffy_Pillow 89814.0/100000: 90% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(11)
0:53.929 default G hand_of_guldan Fluffy_Pillow 89492.0/100000: 89% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(11)
0:55.190 build_a_shard J shadow_bolt Fluffy_Pillow 90753.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(12)
0:56.868 default H demonbolt Fluffy_Pillow 90431.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), archive_of_the_titans(12)
0:58.120 default G hand_of_guldan Fluffy_Pillow 89683.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), archive_of_the_titans(12)
0:59.372 default H demonbolt Fluffy_Pillow 90935.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(12)
1:00.617 build_a_shard J shadow_bolt Fluffy_Pillow 90180.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:02.277 build_a_shard J shadow_bolt Fluffy_Pillow 89840.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:03.936 build_a_shard J shadow_bolt Fluffy_Pillow 89499.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:05.595 default E call_dreadstalkers Fluffy_Pillow 89158.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(14)
1:06.782 default G hand_of_guldan Fluffy_Pillow 90345.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:07.968 build_a_shard J shadow_bolt Fluffy_Pillow 91531.0/100000: 92% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:09.551 default H demonbolt Fluffy_Pillow 91114.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(2), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:10.739 default G hand_of_guldan Fluffy_Pillow 90302.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:11.926 build_a_shard J shadow_bolt Fluffy_Pillow 91489.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:13.509 build_a_shard J shadow_bolt Fluffy_Pillow 91072.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(15)
1:15.091 default G hand_of_guldan Fluffy_Pillow 90654.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:16.279 build_a_shard J shadow_bolt Fluffy_Pillow 91842.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(16)
1:17.980 build_a_shard J shadow_bolt Fluffy_Pillow 91543.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(16)
1:19.681 build_a_shard J shadow_bolt Fluffy_Pillow 91244.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(7), archive_of_the_titans(16)
1:21.381 default G hand_of_guldan Fluffy_Pillow 90944.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), archive_of_the_titans(17)
1:22.657 build_a_shard J shadow_bolt Fluffy_Pillow 92220.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(17)
1:24.357 build_a_shard J shadow_bolt Fluffy_Pillow 91920.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(17)
1:26.057 build_a_shard J shadow_bolt Fluffy_Pillow 91620.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(18)
1:27.757 default H demonbolt Fluffy_Pillow 91320.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(4), archive_of_the_titans(18)
1:29.035 default G hand_of_guldan Fluffy_Pillow 90598.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(18)
1:30.310 default E call_dreadstalkers Fluffy_Pillow 91873.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), archive_of_the_titans(19)
1:31.586 default H demonbolt Fluffy_Pillow 93149.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), archive_of_the_titans(19)
1:32.863 default H demonbolt Fluffy_Pillow 92426.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), archive_of_the_titans(19)
1:34.141 default D summon_vilefiend Fluffy_Pillow 91704.0/100000: 92% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:36.028 default G hand_of_guldan Fluffy_Pillow 93591.0/100000: 94% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20)
1:37.295 build_a_shard J shadow_bolt Fluffy_Pillow 94858.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:38.976 default F summon_demonic_tyrant Fluffy_Pillow 94539.0/100000: 95% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
1:40.655 default 8 potion Fluffy_Pillow 94218.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
1:40.655 build_a_shard J shadow_bolt Fluffy_Pillow 94218.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:42.335 default G hand_of_guldan Fluffy_Pillow 93898.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:43.596 build_a_shard J shadow_bolt Fluffy_Pillow 95159.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:45.276 build_a_shard J shadow_bolt Fluffy_Pillow 94839.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:46.954 build_a_shard J shadow_bolt Fluffy_Pillow 94517.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:48.622 build_a_shard J shadow_bolt Fluffy_Pillow 94185.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:50.281 default E call_dreadstalkers Fluffy_Pillow 93844.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:51.555 default G hand_of_guldan Fluffy_Pillow 95118.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:52.801 build_a_shard J shadow_bolt Fluffy_Pillow 96364.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:54.461 build_a_shard J shadow_bolt Fluffy_Pillow 96024.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(10), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:56.121 default H demonbolt Fluffy_Pillow 95684.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:57.367 default G hand_of_guldan Fluffy_Pillow 94930.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:58.611 default H demonbolt Fluffy_Pillow 96174.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:59.855 default G hand_of_guldan Fluffy_Pillow 95418.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:01.100 default H demonbolt Fluffy_Pillow 96663.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:02.345 default H demonbolt Fluffy_Pillow 95908.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), supreme_commander, wild_imps(13), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:03.590 default G hand_of_guldan Fluffy_Pillow 95153.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(9), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:04.834 default H demonbolt Fluffy_Pillow 96397.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:06.078 default G hand_of_guldan Fluffy_Pillow 95641.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), quick_navigation(4), archive_of_the_titans(20)
2:07.324 default H demonbolt Fluffy_Pillow 96887.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), quick_navigation(4), archive_of_the_titans(20)
2:08.570 default H demonbolt Fluffy_Pillow 96133.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), quick_navigation(4), archive_of_the_titans(20)
2:09.816 build_a_shard J shadow_bolt Fluffy_Pillow 95379.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(9), quick_navigation_final, archive_of_the_titans(20)
2:11.398 default E call_dreadstalkers Fluffy_Pillow 94961.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
2:12.585 default G hand_of_guldan Fluffy_Pillow 96148.0/100000: 96% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:13.770 build_a_shard J shadow_bolt Fluffy_Pillow 97333.0/100000: 97% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:15.353 build_a_shard J shadow_bolt Fluffy_Pillow 96916.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:16.935 default G hand_of_guldan Fluffy_Pillow 96498.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:18.123 default H demonbolt Fluffy_Pillow 97686.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
2:19.161 build_a_shard J shadow_bolt Fluffy_Pillow 96724.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), overwhelming_power(24), archive_of_the_titans(20)
2:20.641 default H demonbolt Fluffy_Pillow 96204.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(23), archive_of_the_titans(20)
2:21.756 default D summon_vilefiend Fluffy_Pillow 95319.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), overwhelming_power(22), archive_of_the_titans(20)
2:23.251 default G hand_of_guldan Fluffy_Pillow 96814.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(20), archive_of_the_titans(20)
2:24.388 default H demonbolt Fluffy_Pillow 97951.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
2:25.523 default G hand_of_guldan Fluffy_Pillow 97086.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
2:26.664 default H demonbolt Fluffy_Pillow 98227.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
2:27.804 build_a_shard J shadow_bolt Fluffy_Pillow 97367.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
2:29.331 build_a_shard J shadow_bolt Fluffy_Pillow 96894.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
2:30.868 build_a_shard J shadow_bolt Fluffy_Pillow 96431.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
2:32.415 default E call_dreadstalkers Fluffy_Pillow 95978.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
2:33.590 default G hand_of_guldan Fluffy_Pillow 97153.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
2:34.771 build_a_shard J shadow_bolt Fluffy_Pillow 98334.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
2:36.354 build_a_shard J shadow_bolt Fluffy_Pillow 97917.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
2:37.955 default G hand_of_guldan Fluffy_Pillow 97518.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:39.163 default H demonbolt Fluffy_Pillow 98726.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
2:40.387 build_a_shard J shadow_bolt Fluffy_Pillow 97950.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
2:42.027 build_a_shard J shadow_bolt Fluffy_Pillow 97590.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
2:43.686 build_a_shard J shadow_bolt Fluffy_Pillow 97249.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:45.356 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96919.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:46.608 build_a_shard J shadow_bolt Fluffy_Pillow 98171.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), quick_navigation(3), archive_of_the_titans(20)
2:48.278 build_a_shard J shadow_bolt Fluffy_Pillow 97841.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation(3), archive_of_the_titans(20)
2:49.947 build_a_shard J shadow_bolt Fluffy_Pillow 97510.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), quick_navigation(3), archive_of_the_titans(20)
2:51.615 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97178.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), archive_of_the_titans(20)
2:52.867 nether_portal_building W call_dreadstalkers Fluffy_Pillow 98430.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
2:54.113 build_a_shard J shadow_bolt Fluffy_Pillow 99676.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:55.773 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:57.433 build_a_shard J shadow_bolt Fluffy_Pillow 97665.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:59.093 build_a_shard J shadow_bolt Fluffy_Pillow 97325.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
3:00.534 nether_portal_building V nether_portal Fluffy_Pillow 96766.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
3:01.577 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97809.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), nether_portal, wild_imps(4), dreadstalkers(2), portal_summons, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
3:02.626 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98858.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), nether_portal, wild_imps, dreadstalkers(2), portal_summons(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
3:03.679 nether_portal_active T demonbolt Fluffy_Pillow 99911.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), nether_portal, wild_imps, dreadstalkers(2), portal_summons(3), quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20)
3:04.739 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98971.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), nether_portal, wild_imps(5), dreadstalkers(2), portal_summons(3), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
3:05.805 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(4), nether_portal, wild_imps(6), portal_summons(4), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:06.874 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99069.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(3), nether_portal, wild_imps(6), portal_summons(4), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
3:07.948 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), nether_portal, wild_imps(7), portal_summons(5), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
3:09.029 nether_portal_active N summon_vilefiend Fluffy_Pillow 99081.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(7), portal_summons(5), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
3:10.486 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(9), vilefiend, portal_summons(6), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
3:11.584 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(7), vilefiend, portal_summons(7), overwhelming_power(13), archive_of_the_titans(20)
3:13.157 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(6), vilefiend, tyrant, portal_summons(7), overwhelming_power(11), archive_of_the_titans(20)
3:13.157 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(6), vilefiend, tyrant, portal_summons(7), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse
3:13.157 nether_portal_active T demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core(3), demonic_power, demonic_calling, nether_portal, wild_imps(6), vilefiend, tyrant, portal_summons(7), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse
3:14.166 nether_portal_active O call_dreadstalkers Fluffy_Pillow 97013.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_core(2), demonic_power, demonic_calling, nether_portal, wild_imps(6), vilefiend, tyrant, portal_summons(7), quick_navigation, overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse
3:15.174 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98021.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_core(2), demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse
3:16.186 nether_portal_active T demonbolt Fluffy_Pillow 99033.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core(2), demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(8), archive_of_the_titans(20), ignition_mages_fuse
3:17.203 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98050.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_core, demonic_power, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.195 nether_portal_active T demonbolt Fluffy_Pillow 99042.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.193 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98040.0/100000: 98% mana | 2.0/5: 40% soul_shard berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, overwhelming_power(5), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.198 build_a_shard J shadow_bolt Fluffy_Pillow 99045.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.536 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.838 build_a_shard J shadow_bolt Fluffy_Pillow 97307.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.149 default G hand_of_guldan Fluffy_Pillow 96618.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.294 build_a_shard J shadow_bolt Fluffy_Pillow 97763.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:26.773 default H demonbolt Fluffy_Pillow 97242.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(12), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.884 default G hand_of_guldan Fluffy_Pillow 96353.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(14), vilefiend, tyrant, portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.992 default H demonbolt Fluffy_Pillow 97461.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(14), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.100 default H demonbolt Fluffy_Pillow 96569.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.178 build_a_shard J shadow_bolt Fluffy_Pillow 95647.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(16), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.615 default G hand_of_guldan Fluffy_Pillow 95084.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(14), vilefiend, quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.693 build_a_shard J shadow_bolt Fluffy_Pillow 96162.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(14), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:35.372 default E call_dreadstalkers Fluffy_Pillow 95841.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:36.633 default H demonbolt Fluffy_Pillow 97102.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(3), supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:37.895 default G hand_of_guldan Fluffy_Pillow 96364.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:39.154 default H demonbolt Fluffy_Pillow 97623.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(3), supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:40.405 default G hand_of_guldan Fluffy_Pillow 96874.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
3:41.659 default H demonbolt Fluffy_Pillow 98128.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:42.912 default H demonbolt Fluffy_Pillow 97381.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(8), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:44.165 default G hand_of_guldan Fluffy_Pillow 96634.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:45.417 build_a_shard J shadow_bolt Fluffy_Pillow 97886.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:47.085 build_a_shard J shadow_bolt Fluffy_Pillow 97554.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(8), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:48.754 default G hand_of_guldan Fluffy_Pillow 97223.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(9), quick_navigation(3), archive_of_the_titans(20)
3:50.006 default H demonbolt Fluffy_Pillow 98475.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:51.252 default H demonbolt Fluffy_Pillow 97721.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:52.497 build_a_shard J shadow_bolt Fluffy_Pillow 96966.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:54.155 default G hand_of_guldan Fluffy_Pillow 96624.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation(4), archive_of_the_titans(20)
3:55.402 default D summon_vilefiend Fluffy_Pillow 97871.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
3:57.062 default E call_dreadstalkers Fluffy_Pillow 99531.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:58.250 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
3:59.834 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:01.416 build_a_shard J shadow_bolt Fluffy_Pillow 97588.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:02.996 default G hand_of_guldan Fluffy_Pillow 97168.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:04.183 build_a_shard J shadow_bolt Fluffy_Pillow 98355.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
4:05.567 build_a_shard J shadow_bolt Fluffy_Pillow 97739.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, overwhelming_power(24), archive_of_the_titans(20)
4:07.046 build_a_shard J shadow_bolt Fluffy_Pillow 97218.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(22), archive_of_the_titans(20)
4:08.542 default G hand_of_guldan Fluffy_Pillow 96714.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(21), archive_of_the_titans(20)
4:09.671 default H demonbolt Fluffy_Pillow 97843.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, overwhelming_power(20), archive_of_the_titans(20)
4:10.805 default H demonbolt Fluffy_Pillow 96977.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, overwhelming_power(19), archive_of_the_titans(20)
4:11.946 default G hand_of_guldan Fluffy_Pillow 96118.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
4:13.087 build_a_shard J shadow_bolt Fluffy_Pillow 97259.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
4:14.616 build_a_shard J shadow_bolt Fluffy_Pillow 96788.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
4:16.154 build_a_shard J shadow_bolt Fluffy_Pillow 96326.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
4:17.710 default E call_dreadstalkers Fluffy_Pillow 95882.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
4:18.885 default G hand_of_guldan Fluffy_Pillow 97057.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
4:20.067 default H demonbolt Fluffy_Pillow 98239.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
4:21.263 build_a_shard J shadow_bolt Fluffy_Pillow 97435.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
4:22.864 default G hand_of_guldan Fluffy_Pillow 97036.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
4:24.067 build_a_shard J shadow_bolt Fluffy_Pillow 98239.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
4:25.685 build_a_shard J shadow_bolt Fluffy_Pillow 97857.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
4:27.316 build_a_shard J shadow_bolt Fluffy_Pillow 97488.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power(2), archive_of_the_titans(20)
4:28.966 default G hand_of_guldan Fluffy_Pillow 97138.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(4), overwhelming_power, archive_of_the_titans(20)
4:30.205 build_a_shard J shadow_bolt Fluffy_Pillow 98377.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), archive_of_the_titans(20)
4:31.863 build_a_shard J shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
4:33.524 default H demonbolt Fluffy_Pillow 97664.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
4:34.711 build_a_shard J shadow_bolt Fluffy_Pillow 96851.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
4:36.293 default G hand_of_guldan Fluffy_Pillow 96433.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:37.481 default E call_dreadstalkers Fluffy_Pillow 97621.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
4:38.897 default H demonbolt Fluffy_Pillow 99037.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:40.084 default H demonbolt Fluffy_Pillow 98224.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:41.272 default G hand_of_guldan Fluffy_Pillow 97412.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:42.459 default D summon_vilefiend Fluffy_Pillow 98599.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:44.042 default F summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:45.742 default H demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:47.019 default G hand_of_guldan Fluffy_Pillow 97281.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:48.287 default H demonbolt Fluffy_Pillow 98549.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:49.556 build_a_shard J shadow_bolt Fluffy_Pillow 97818.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:51.246 default G hand_of_guldan Fluffy_Pillow 97508.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:52.515 build_a_shard J shadow_bolt Fluffy_Pillow 98777.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:54.204 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:55.893 build_a_shard J shadow_bolt Fluffy_Pillow 97693.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:57.357 build_a_shard J shadow_bolt Fluffy_Pillow 97157.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
4:58.836 default E call_dreadstalkers Fluffy_Pillow 96636.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:59.946 default G hand_of_guldan Fluffy_Pillow 97746.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DL_ID_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=1103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

DStr_GF_Felguard : 17549 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17549.2 17549.2 16.0 / 0.091% 2223.0 / 12.7% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
940.7 932.5 Mana 0.00% 47.5 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_GF_Felguard 17549
Demonbolt 1236 7.1% 43.5 6.29sec 8516 7478 Direct 44.4 7099 14201 8354 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.53 44.38 0.00 0.00 1.1388 0.0000 370740.44 370740.44 0.00 7478.22 7478.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.53 82.32% 7098.55 6520 8308 7099.44 6904 7280 259332 259332 0.00
crit 7.84 17.68% 14201.36 13040 16616 14193.74 0 16616 111409 111409 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1025 5.9% 59.3 4.97sec 5190 4718 Direct 59.2 4419 8832 5201 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.29 59.16 0.00 0.00 1.1001 0.0000 307683.50 307683.50 0.00 4717.77 4717.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.68 82.28% 4418.59 1634 5979 4412.36 3977 4756 215104 215104 0.00
crit 10.48 17.72% 8832.43 3267 11958 8811.16 0 11159 92579 92579 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 37.00sec 8280 0 Direct 7.3 4925 9849 5791 17.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 7.33 0.00 0.00 0.0000 0.0000 42436.07 42436.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.04 82.41% 4924.62 4925 4925 4921.67 0 4925 29742 29742 0.00
crit 1.29 17.59% 9849.24 9849 9849 7140.16 0 9849 12694 12694 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.3% 7.3 37.00sec 2489 0 Direct 7.3 2111 4221 2489 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 7.33 0.00 0.00 0.0000 0.0000 18240.93 18240.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.06% 2110.55 2111 2111 2109.29 0 2111 12692 12692 0.00
crit 1.31 17.94% 4221.10 4221 4221 3100.60 0 4221 5548 5548 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1302 7.4% 93.0 3.14sec 4199 2814 Direct 92.3 3592 7185 4229 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.97 92.32 0.00 0.00 1.4925 0.0000 390406.52 390406.52 0.00 2813.56 2813.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.97 82.29% 3592.38 3335 4297 3593.00 3552 3646 272925 272925 0.00
crit 16.35 17.71% 7185.26 6670 8595 7186.06 6913 7532 117482 117482 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 36.73sec 11863 0 Direct 7.2 10240 20481 12027 17.5%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 7.21 0.00 0.00 0.0000 0.0000 86766.17 86766.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 82.55% 10240.44 10240 10240 10236.34 0 10240 60980 60980 0.00
crit 1.26 17.45% 20480.88 20481 20481 14745.09 0 20481 25786 25786 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3736 / 3736
(demonic_strength_) Felstorm 795 4.5% 5.4 60.70sec 43888 11446 Periodic 32.4 6241 12484 7355 17.8% 6.9%

Stats details: demonic_strength_felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.42 0.00 32.37 32.37 3.8345 0.6426 238052.08 340324.04 30.05 11445.91 11445.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.6 82.16% 6241.31 5816 7641 6238.46 6033 6545 165968 237272 30.05
crit 5.8 17.84% 12483.66 11633 15282 12455.54 0 15282 72084 103052 30.00
 
 

Action details: demonic_strength_felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Felstorm 368 2.1% 10.2 30.59sec 10850 2863 Periodic 60.6 1546 3092 1820 17.7% 12.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.17 0.00 60.62 60.62 3.7897 0.6358 110342.16 157747.36 30.05 2863.06 2863.06
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.9 82.28% 1546.19 1428 1910 1546.23 1514 1596 77121 110254 30.05
crit 10.7 17.72% 3091.98 2856 3820 3092.10 2942 3446 33221 47493 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 971 5.5% 53.2 5.53sec 5463 5438 Direct 53.2 4648 9299 5463 17.5%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.22 53.22 0.00 0.00 1.0045 0.0000 290749.05 415660.69 30.05 5438.42 5438.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.90 82.49% 4648.17 4179 5592 4649.30 4543 4785 204062 291731 30.05
crit 9.32 17.51% 9299.49 8359 11183 9302.05 8420 10737 86687 123930 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1603 9.1% 161.1 1.82sec 2982 2022 Direct 161.1 2534 5068 2982 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.12 161.12 0.00 0.00 1.4743 0.0000 480420.68 686819.06 30.05 2022.49 2022.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.65 82.33% 2534.01 2284 3056 2534.52 2486 2587 336131 480540 30.05
crit 28.47 17.67% 5067.81 4569 6113 5069.03 4802 5436 144289 206279 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - grimoire_felguard 4769 / 1030
Felstorm 653 0.8% 3.9 80.69sec 10656 3645 Periodic 19.4 1832 3662 2157 17.7% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 19.42 19.42 2.9238 0.5918 41894.78 59893.62 30.05 3644.93 3644.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.26% 1832.22 1715 2197 1832.94 1776 2010 29274 41851 30.05
crit 3.4 17.74% 3661.85 3430 4393 3573.39 0 4393 12620 18042 29.32
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1848 2.3% 18.4 13.86sec 6435 6435 Direct 18.4 5472 10935 6434 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.44 18.44 0.00 0.00 1.0000 0.0000 118669.83 169652.78 30.05 6434.76 6434.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.19 82.37% 5471.68 5020 6430 5474.39 5209 5948 83119 118828 30.05
crit 3.25 17.63% 10934.65 10040 12861 10595.15 0 12493 35551 50825 29.10
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2268 2.8% 41.0 6.32sec 3552 3008 Direct 41.0 3018 6032 3552 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.97 40.97 0.00 0.00 1.1810 0.0000 145521.88 208041.00 30.05 3007.96 3007.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.70 82.27% 3017.81 2744 3515 3018.89 2930 3218 101708 145403 30.05
crit 7.26 17.73% 6032.23 5488 7030 6029.66 0 6694 43814 62638 30.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - illidari_satyr 1276 / 171
melee 422 0.3% 42.9 2.63sec 390 333 Direct 42.9 332 664 390 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.87 42.87 0.00 0.00 1.1721 0.0000 16734.18 23923.51 30.05 333.01 333.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.31 82.36% 331.81 294 358 332.20 294 357 11716 16750 30.05
crit 7.56 17.64% 663.60 587 717 655.46 0 717 5018 7174 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 211 0.2% 42.9 2.63sec 195 158 Direct 42.9 166 332 195 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.87 42.87 0.00 0.00 1.2395 0.0000 8371.65 11968.29 30.05 157.54 157.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 82.30% 165.89 147 179 166.10 147 179 5854 8368 30.05
crit 7.59 17.70% 331.90 294 358 327.94 0 358 2518 3600 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 642 0.5% 9.1 12.79sec 2811 2811 Direct 9.1 2394 4790 2811 17.4%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.12 9.12 0.00 0.00 1.0000 0.0000 25642.48 25642.48 0.00 2810.75 2810.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.54 82.61% 2393.79 2116 2582 2393.03 0 2582 18042 18042 0.00
crit 1.59 17.39% 4789.68 4233 5163 3566.38 0 5163 7600 7600 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - urzul 1350 / 180
Many Faced Bite 504 0.4% 9.4 12.14sec 2116 2116 Direct 9.4 1792 3585 2116 18.1%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.45 9.45 0.00 0.00 1.0000 0.0000 19994.10 28583.97 30.05 2116.00 2116.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.74 81.92% 1791.60 1586 1935 1790.86 0 1935 13870 19828 30.00
crit 1.71 18.08% 3584.68 3172 3870 2766.86 0 3870 6125 8756 23.20
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 846 0.6% 42.7 2.61sec 782 668 Direct 42.7 664 1328 782 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.71 42.71 0.00 0.00 1.1700 0.0000 33386.89 47730.58 30.05 668.19 668.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.12 82.24% 663.93 587 717 664.70 587 714 23318 33335 30.05
crit 7.59 17.76% 1327.51 1175 1433 1310.08 0 1433 10069 14395 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3189 / 1518
Bile Spit 1150 3.1% 6.7 47.34sec 24234 0 Direct 6.7 8905 17799 10474 17.6%  
Periodic 33.0 2820 0 2820 0.0% 22.0%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.73 32.95 32.95 0.0000 2.0000 163435.20 163435.20 0.00 2479.71 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.54 82.35% 8905.10 8505 10104 8905.65 8505 9547 49371 49371 0.00
crit 1.19 17.65% 17799.07 17011 20207 12932.16 0 20207 21146 21146 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.0 100.00% 2819.59 2502 3310 2820.64 2628 2886 92919 92919 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.0% 28.7 10.14sec 3656 3656 Direct 28.7 3107 6215 3656 17.7%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.71 28.71 0.00 0.00 1.0000 0.0000 104961.35 150054.86 30.05 3656.17 3656.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.64 82.33% 3107.01 2737 3621 3108.66 2961 3257 73442 104994 30.05
crit 5.07 17.67% 6214.96 5474 7243 6183.61 0 7243 31520 45061 29.89
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1305 3.5% 103.5 2.79sec 1799 1351 Direct 103.5 1529 3058 1799 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.48 103.48 0.00 0.00 1.3316 0.0000 186206.91 266205.13 30.05 1351.28 1351.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.20 82.34% 1529.35 1342 1775 1529.98 1478 1580 130303 186284 30.05
crit 18.28 17.66% 3058.31 2683 3550 3059.63 2808 3329 55903 79921 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - shivarra 1949 / 263
melee 842 0.6% 42.9 2.70sec 781 667 Direct 42.9 664 1327 781 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.89 42.89 0.00 0.00 1.1716 0.0000 33510.84 47907.77 30.05 666.96 666.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.28 82.27% 663.80 587 717 664.54 587 714 23420 33482 30.05
crit 7.60 17.73% 1327.20 1175 1433 1309.54 0 1433 10091 14426 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 420 0.3% 42.9 2.70sec 390 315 Direct 42.9 332 664 390 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.89 42.89 0.00 0.00 1.2393 0.0000 16729.26 23916.49 30.05 314.76 314.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.36 82.45% 331.90 294 358 332.29 294 357 11736 16778 30.05
crit 7.52 17.55% 663.53 587 717 657.21 0 717 4993 7138 29.73
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (93) 0.0% (0.5%) 0.0 0.00sec 0 3971

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3971.46 3971.46
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.9 18.10sec 993 0 Direct 6.9 843 1684 993 17.8%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.0000 0.0000 6869.09 9820.19 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 82.17% 843.35 749 914 839.60 0 914 4793 6852 29.86
crit 1.23 17.83% 1683.74 1498 1827 1152.96 0 1827 2076 2969 20.56
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 172 0.1% 6.9 18.10sec 994 0 Direct 6.9 843 1686 994 17.9%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.0000 0.0000 6873.62 9826.66 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 82.11% 843.15 749 914 839.52 0 914 4788 6845 29.88
crit 1.24 17.89% 1685.64 1498 1827 1127.31 0 1827 2085 2981 20.09
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 172 0.1% 6.9 18.10sec 994 0 Direct 6.9 843 1687 994 17.9%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.0000 0.0000 6872.79 9825.48 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.68 82.14% 842.95 749 914 842.38 0 914 4789 6846 29.98
crit 1.23 17.86% 1687.45 1498 1827 1135.50 0 1827 2084 2979 20.22
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 172 0.1% 6.9 18.10sec 991 0 Direct 6.9 843 1686 991 17.5%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 0.0000 0.0000 6851.14 9794.53 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.71 82.50% 843.08 749 914 840.33 0 914 4811 6877 29.91
crit 1.21 17.50% 1686.29 1498 1827 1145.47 0 1827 2041 2917 20.41
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - dreadstalker 3373 / 2225
Dreadbite 1064 4.0% 29.0 20.96sec 7261 0 Direct 29.0 6173 12344 7261 17.6%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.98 28.98 0.00 0.00 0.0000 0.0000 210431.43 210431.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.88 82.38% 6173.33 5732 7613 6173.80 5984 6388 147393 147393 0.00
crit 5.11 17.62% 12344.03 11464 15227 12291.10 0 15227 63039 63039 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2309 8.7% 312.2 1.88sec 1463 1106 Direct 312.2 1244 2487 1463 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.24 312.24 0.00 0.00 1.3226 0.0000 456760.88 652994.53 30.05 1106.01 1106.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.17 82.36% 1243.51 1101 1473 1243.70 1227 1264 319790 457178 30.05
crit 55.08 17.64% 2486.87 2203 2947 2487.24 2374 2618 136971 195817 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - eye_of_guldan 999 / 83
Eye of Gul'dan 999 0.5% 28.2 5.32sec 875 1151 Periodic 61.5 400 0 400 0.0% 60.2%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.15 0.00 61.54 61.54 0.7596 2.9360 24620.04 24620.04 0.00 121.84 1151.28
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.5 100.00% 400.04 182 461 399.12 379 405 24620 24620 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - wild_imp 2557 / 2435
Fel Firebolt 2557 13.9% 977.9 0.30sec 747 502 Direct 973.9 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 977.92 973.89 0.00 0.00 1.4860 0.0000 730201.47 730201.47 0.00 502.48 502.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 801.90 82.34% 637.25 569 761 637.27 626 649 511011 511011 0.00
crit 171.98 17.66% 1274.50 1138 1523 1274.53 1232 1315 219190 219190 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4662 / 821
Demonfire 4662 4.7% 37.7 6.92sec 6522 4890 Direct 37.6 5562 11122 6537 17.5%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.59 0.00 0.00 1.3337 0.0000 245698.73 245698.73 0.00 4890.31 4890.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.00 82.46% 5561.74 5029 5917 5565.08 5444 5661 172392 172392 0.00
crit 6.59 17.54% 11121.78 10059 11834 11110.32 0 11834 73307 73307 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - void_terror 1841 / 249
Double Breath 0 (135) 0.0% (0.8%) 0.0 0.00sec 0 7418

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7418.19 7418.19
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 495 0.4% 7.1 17.64sec 2803 0 Direct 7.1 2386 4773 2803 17.5%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 0.00 0.00 0.0000 0.0000 19812.40 19812.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.83 82.52% 2386.01 2116 2582 2384.57 0 2582 13915 13915 0.00
crit 1.24 17.48% 4772.96 4233 5163 3254.15 0 5163 5898 5898 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 498 0.4% 7.1 17.64sec 2818 0 Direct 7.1 2385 4779 2819 18.1%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 0.00 0.00 0.0000 0.0000 19919.41 19919.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.79 81.91% 2385.35 2116 2582 2382.75 0 2582 13808 13808 0.00
crit 1.28 18.09% 4778.91 4233 5163 3329.18 0 5163 6112 6112 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 848 0.6% 43.1 2.68sec 782 669 Direct 43.1 664 1328 782 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.10 43.10 0.00 0.00 1.1693 0.0000 33693.99 48169.60 30.05 668.60 668.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.44 82.22% 663.75 587 717 664.54 587 714 23520 33625 30.05
crit 7.66 17.78% 1327.92 1175 1433 1311.38 0 1433 10174 14545 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - bilescourge 3936 / 522
Toxic Bile 3936 2.9% 54.8 2.04sec 2825 3043 Direct 54.8 2397 4796 2825 17.8%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.76 54.76 0.00 0.00 0.9285 0.0000 154711.18 154711.18 0.00 3043.10 3043.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.98 82.15% 2397.16 2116 2582 2398.55 2116 2571 107832 107832 0.00
crit 9.77 17.85% 4796.36 4233 5163 4763.73 0 5163 46879 46879 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - darkhound 1319 / 175
Fel Bite 473 0.4% 8.8 12.97sec 2113 2113 Direct 8.8 1793 3590 2113 17.8%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 1.0000 0.0000 18696.16 26728.40 30.05 2113.28 2113.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.27 82.20% 1793.46 1586 1935 1791.89 0 1935 13043 18647 29.97
crit 1.57 17.80% 3590.17 3172 3870 2679.95 0 3870 5653 8081 22.41
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 846 0.6% 42.5 2.59sec 781 667 Direct 42.5 664 1328 781 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.53 42.53 0.00 0.00 1.1701 0.0000 33212.25 47480.89 30.05 667.44 667.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.02 82.35% 663.84 587 717 664.76 587 714 23247 33235 30.05
crit 7.51 17.65% 1327.62 1175 1433 1309.94 0 1433 9965 14246 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1074 / 144
Demon Fangs 661 0.5% 9.4 12.49sec 2810 2810 Direct 9.4 2391 4788 2810 17.5%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.37 9.37 0.00 0.00 1.0000 0.0000 26334.41 26334.41 0.00 2810.20 2810.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.73 82.53% 2391.49 2116 2582 2391.07 0 2582 18496 18496 0.00
crit 1.64 17.47% 4787.80 4233 5163 3659.33 0 5163 7838 7838 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 413 0.3% 83.5 1.35sec 196 327 Direct 83.5 166 333 196 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.53 83.53 0.00 0.00 0.5984 0.0000 16349.84 23374.06 30.05 327.09 327.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.73 82.29% 166.28 147 179 166.43 147 177 11429 16339 30.05
crit 14.80 17.71% 332.61 294 358 332.48 0 358 4921 7035 30.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - wrathguard 1733 / 232
melee 843 0.6% 42.7 2.66sec 781 668 Direct 42.7 664 1327 781 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 1.1684 0.0000 33311.72 47623.10 30.05 668.41 668.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.14 82.37% 664.05 587 717 664.90 587 714 23332 33357 30.05
crit 7.52 17.63% 1327.36 1175 1433 1310.40 0 1433 9979 14267 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 422 0.3% 42.7 2.66sec 391 316 Direct 42.7 332 664 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 1.2356 0.0000 16667.44 23828.10 30.05 316.23 316.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.10 82.30% 332.00 294 358 332.41 294 357 11655 16662 30.05
crit 7.55 17.70% 663.95 587 717 656.46 0 717 5013 7166 29.68
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.8 13.29sec 2107 2107 Direct 8.8 1795 3591 2107 17.4%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.85 8.85 0.00 0.00 1.0000 0.0000 18642.47 26651.64 30.05 2107.45 2107.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.31 82.59% 1794.63 1586 1935 1792.82 0 1935 13111 18744 29.95
crit 1.54 17.41% 3590.59 3172 3870 2661.29 0 3870 5531 7908 22.27
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - prince_malchezaar 4660 / 389
melee 3110 1.5% 20.9 1.39sec 3690 3133 Direct 20.9 3144 6278 3690 17.4%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.89 20.89 0.00 0.00 1.1778 0.0000 77077.31 110191.28 30.05 3133.22 3133.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.24 82.56% 3143.89 2784 3396 3151.31 2784 3385 54215 77507 30.05
crit 3.64 17.44% 6277.82 5567 6791 6107.30 0 6791 22862 32684 29.14
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1551 0.7% 20.9 1.39sec 1842 1479 Direct 20.9 1572 3136 1842 17.2%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.89 20.89 0.00 0.00 1.2457 0.0000 38470.45 54998.13 30.05 1478.67 1478.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 82.76% 1572.23 1392 1698 1576.02 1392 1692 27176 38851 30.05
crit 3.60 17.24% 3136.14 2784 3396 3004.35 0 3396 11295 16147 28.71
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_GF_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.5 20.96sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 0.00 0.00 0.00 1.2031 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
Demonic Strength 5.5 60.47sec

Stats details: demonic_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 0.00 0.00 1.2153 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demonic_strength

Static Values
  • id:267171
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
Spelldata
  • id:267171
  • name:Demonic Strength
  • school:shadow
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Felguard
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.75sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.1265 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 183.60sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0908 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.66sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 0.00 0.00 1.5103 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 15.2 13.86sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.7 47.34sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 0.00 0.00 0.00 1.5402 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.08sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.1sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.6sec 187.6sec 6.76% 8.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.7 14.9 23.4sec 10.4sec 51.23% 83.19% 14.9(14.9) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.23%

Trigger Attempt Success

  • trigger_pct:20.03%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 22.7 30.3 12.7sec 5.3sec 39.73% 100.00% 4.5(4.5) 0.4

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.96%
  • demonic_core_2:16.15%
  • demonic_core_3:5.33%
  • demonic_core_4:2.30%

Trigger Attempt Success

  • trigger_pct:26.02%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.7sec 93.7sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.6 26.8sec 10.1sec 65.98% 0.00% 0.0(0.0) 10.8

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.47%
  • dreadstalkers_4:6.50%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.4 184.6sec 3.0sec 1.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.13%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.8sec 120.8sec 19.70% 0.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.9sec 171.9sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.03%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 183.5sec 183.5sec 10.14% 18.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 67.0sec 36.4sec 44.11% 0.00% 3.0(41.8) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.36%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.04%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.16%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.35%
  • overwhelming_power_24:2.41%
  • overwhelming_power_25:1.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.2 183.5sec 13.9sec 19.56% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.92%
  • portal_summons_2:0.77%
  • portal_summons_3:1.24%
  • portal_summons_4:1.89%
  • portal_summons_5:1.43%
  • portal_summons_6:1.80%
  • portal_summons_7:4.24%
  • portal_summons_8:5.87%
  • portal_summons_9:0.40%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 183.3sec 94.5sec 1.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.60%
  • quick_navigation_2:17.22%
  • quick_navigation_3:16.62%
  • quick_navigation_4:16.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.2sec 52.2sec 17.45% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.6sec 79.9sec 17.01% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.7sec 93.7sec 17.62% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.62%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.7 0.0 47.4sec 47.4sec 47.72% 0.00% 0.0(0.0) 6.3

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.72%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.4 149.5 54.8sec 0.0sec 95.23% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.33%
  • wild_imps_2:2.80%
  • wild_imps_3:29.83%
  • wild_imps_4:7.72%
  • wild_imps_5:9.36%
  • wild_imps_6:24.69%
  • wild_imps_7:5.41%
  • wild_imps_8:3.71%
  • wild_imps_9:4.86%
  • wild_imps_10:1.52%
  • wild_imps_11:1.16%
  • wild_imps_12:1.17%
  • wild_imps_13:0.46%
  • wild_imps_14:0.14%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
  • wild_imps_18:0.00%
felguard: Demonic Strength 5.5 0.0 60.5sec 60.5sec 10.75% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard_felguard
  • cooldown name:buff_demonic_strength
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_strength_1:10.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267171
  • name:Demonic Strength
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.8sec 120.8sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Felguard_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_GF_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.2 13.9sec
one_shard_hog 9.2 21.9sec
two_shard_hog 3.6 17.4sec
three_shard_hog 46.4 6.0sec
portal_summon 15.2 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_GF_Felguard
call_dreadstalkers Soul Shard 14.5 17.0 1.2 1.2 0.0
demonbolt Mana 44.5 89061.4 2000.0 2045.8 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 59.3 155.7 2.6 2.6 1975.8
shadow_bolt Mana 93.0 185949.2 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7184.5 2000.0 2000.1 0.0
summon_vilefiend Soul Shard 6.7 6.7 1.0 1.0 0.0
pet - felguard
demonic_strength_felstorm Energy 5.4 325.4 60.0 60.0 731.5
felstorm Energy 10.2 610.2 60.0 60.0 180.8
legion_strike Energy 53.2 3193.4 60.0 60.0 91.0
pet - grimoire_felguard
felstorm Energy 3.9 235.9 60.0 60.0 177.6
legion_strike Energy 18.4 1106.5 60.0 60.0 107.2
pet - wild_imp
fel_firebolt Energy 977.9 15199.1 15.5 15.5 48.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 44.53 89.04 (48.92%) 2.00 0.03 0.03%
shadow_bolt Soul Shard 92.97 92.97 (51.08%) 1.00 0.00 0.00%
mana_regen Mana 552.32 279724.23 (100.00%) 506.45 19720.41 6.59%
pet - felguard
energy_regen Energy 378.88 3989.13 (100.00%) 10.53 18.58 0.46%
pet - grimoire_felguard
energy_regen Energy 91.62 914.25 (100.00%) 9.98 48.36 5.02%
pet - demonic_tyrant
energy_regen Energy 37.67 0.00 (0.00%) 0.00 760.52 100.00%
pet - bilescourge
energy_regen Energy 7.44 0.00 (0.00%) 0.00 103.11 100.00%
pet - bilescourge
energy_regen Energy 11.49 0.00 (0.00%) 0.00 158.02 100.00%
pet - bilescourge
energy_regen Energy 14.39 0.00 (0.00%) 0.00 199.02 100.00%
pet - bilescourge
energy_regen Energy 12.14 0.00 (0.00%) 0.00 167.77 100.00%
pet - bilescourge
energy_regen Energy 5.59 0.00 (0.00%) 0.00 77.00 100.00%
Resource RPS-Gain RPS-Loss
Mana 932.45 940.69
Soul Shard 0.61 0.61
Combat End Resource Mean Min Max
Mana 97525.71 93776.00 100000.00
Soul Shard 2.59 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.1%

Statistics & Data Analysis

Fight Length
Sample Data DStr_GF_Felguard Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_GF_Felguard Damage Per Second
Count 4999
Mean 17549.19
Minimum 15730.90
Maximum 19683.47
Spread ( max - min ) 3952.57
Range [ ( max - min ) / 2 * 100% ] 11.26%
Standard Deviation 577.8469
5th Percentile 16675.99
95th Percentile 18562.35
( 95th Percentile - 5th Percentile ) 1886.37
Mean Distribution
Standard Deviation 8.1728
95.00% Confidence Intervall ( 17533.17 - 17565.21 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4165
0.1 Scale Factor Error with Delta=300 2851
0.05 Scale Factor Error with Delta=300 11402
0.01 Scale Factor Error with Delta=300 285043
Priority Target DPS
Sample Data DStr_GF_Felguard Priority Target Damage Per Second
Count 4999
Mean 17549.19
Minimum 15730.90
Maximum 19683.47
Spread ( max - min ) 3952.57
Range [ ( max - min ) / 2 * 100% ] 11.26%
Standard Deviation 577.8469
5th Percentile 16675.99
95th Percentile 18562.35
( 95th Percentile - 5th Percentile ) 1886.37
Mean Distribution
Standard Deviation 8.1728
95.00% Confidence Intervall ( 17533.17 - 17565.21 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4165
0.1 Scale Factor Error with Delta=300 2851
0.05 Scale Factor Error with Delta=300 11402
0.01 Scale Factor Error with Delta=300 285043
DPS(e)
Sample Data DStr_GF_Felguard Damage Per Second (Effective)
Count 4999
Mean 17549.19
Minimum 15730.90
Maximum 19683.47
Spread ( max - min ) 3952.57
Range [ ( max - min ) / 2 * 100% ] 11.26%
Damage
Sample Data DStr_GF_Felguard Damage
Count 4999
Mean 1216273.63
Minimum 872872.72
Maximum 1628465.59
Spread ( max - min ) 755592.87
Range [ ( max - min ) / 2 * 100% ] 31.06%
DTPS
Sample Data DStr_GF_Felguard Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_GF_Felguard Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_GF_Felguard Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_GF_Felguard Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_GF_Felguard Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_GF_Felguard Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_GF_FelguardTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_GF_Felguard Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
B 5.46 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
C 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
D 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
E 1.97 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
F 4.78 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
G 11.55 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
H 1.61 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
I 43.25 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
J 39.91 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
K 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
L 93.47 shadow_bolt
actions.nether_portal_active
# count action,conditions
P 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Q 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
R 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
S 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
T 13.91 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
U 1.97 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
V 0.02 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
W 3.63 demonbolt,if=buff.demonic_core.up
X 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
Y 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Z 1.01 call_dreadstalkers
a 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
b 1.80 hand_of_guldan,if=soul_shard>=5
c 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367BYPQRTU9ALTLTLTLTLTLTLLLLLIGJILLLIJJILJIJIJLLLGLIFJIJLILJBIJLLGILLLILLLIJLIJLLGJIJLLFH8ILLILLLGLILJIJBEJIJJLIJGILJILLLLFIJJLIGLLIJLLLbLLLbLZLLLbBLLLYTTWQRU9AWTLTLTLTLLLILJLGIJLILJIJLIJJLIJGILLFBELLJIJLLGILLILLLILLLLLIJLGIJILLFHJILLLLL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_GF_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 default B demonic_strength Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_building Y nether_portal Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.259 nether_portal_active P grimoire_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.243 nether_portal_active Q summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:04.552 nether_portal_active R call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), quick_navigation, archive_of_the_titans, battle_potion_of_intellect
0:05.853 nether_portal_active T hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:06.829 nether_portal_active U summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.131 default 9 use_items Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.131 default A berserking Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.131 build_a_shard L shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.227 nether_portal_active T hand_of_guldan Fluffy_Pillow 97102.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.048 build_a_shard L shadow_bolt Fluffy_Pillow 97923.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.141 nether_portal_active T hand_of_guldan Fluffy_Pillow 97016.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.963 build_a_shard L shadow_bolt Fluffy_Pillow 97838.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.057 nether_portal_active T hand_of_guldan Fluffy_Pillow 96932.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.848 build_a_shard L shadow_bolt Fluffy_Pillow 97723.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.902 nether_portal_active T hand_of_guldan Fluffy_Pillow 96777.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), quick_navigation(2), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.695 build_a_shard L shadow_bolt Fluffy_Pillow 97570.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.748 nether_portal_active T hand_of_guldan Fluffy_Pillow 96623.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.514 build_a_shard L shadow_bolt Fluffy_Pillow 97389.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.536 nether_portal_active T hand_of_guldan Fluffy_Pillow 96411.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.419 build_a_shard L shadow_bolt Fluffy_Pillow 97294.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.592 build_a_shard L shadow_bolt Fluffy_Pillow 96467.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.730 build_a_shard L shadow_bolt Fluffy_Pillow 95605.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.869 build_a_shard L shadow_bolt Fluffy_Pillow 94744.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:24.008 build_a_shard L shadow_bolt Fluffy_Pillow 93883.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.146 default I hand_of_guldan Fluffy_Pillow 93021.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:25.977 default G call_dreadstalkers Fluffy_Pillow 93852.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.807 default J demonbolt Fluffy_Pillow 94682.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.637 default I hand_of_guldan Fluffy_Pillow 93512.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.462 build_a_shard L shadow_bolt Fluffy_Pillow 94337.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6)
0:29.746 build_a_shard L shadow_bolt Fluffy_Pillow 93621.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(3), archive_of_the_titans(6)
0:31.032 build_a_shard L shadow_bolt Fluffy_Pillow 92907.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(7)
0:32.316 default I hand_of_guldan Fluffy_Pillow 92191.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:33.274 default J demonbolt Fluffy_Pillow 93149.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:34.232 default J demonbolt Fluffy_Pillow 92107.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(7)
0:35.188 default I hand_of_guldan Fluffy_Pillow 91063.0/100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(8)
0:36.148 build_a_shard L shadow_bolt Fluffy_Pillow 92023.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(8)
0:37.425 default J demonbolt Fluffy_Pillow 91300.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(8)
0:38.340 default I hand_of_guldan Fluffy_Pillow 90215.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(8)
0:39.253 default J demonbolt Fluffy_Pillow 91128.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(8)
0:40.169 default I hand_of_guldan Fluffy_Pillow 90044.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:41.085 default J demonbolt Fluffy_Pillow 90960.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(9)
0:42.273 build_a_shard L shadow_bolt Fluffy_Pillow 90148.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, archive_of_the_titans(9)
0:43.856 build_a_shard L shadow_bolt Fluffy_Pillow 89731.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(8), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(9)
0:45.240 build_a_shard L shadow_bolt Fluffy_Pillow 89115.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(10)
0:46.638 default G call_dreadstalkers Fluffy_Pillow 88513.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(10)
0:47.692 build_a_shard L shadow_bolt Fluffy_Pillow 89567.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), overwhelming_power(21), archive_of_the_titans(10)
0:49.196 default I hand_of_guldan Fluffy_Pillow 89071.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), overwhelming_power(19), archive_of_the_titans(10)
0:50.339 default F summon_vilefiend Fluffy_Pillow 90214.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core(2), dreadstalkers(2), overwhelming_power(18), archive_of_the_titans(11)
0:51.870 default J demonbolt Fluffy_Pillow 91745.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps, dreadstalkers(2), vilefiend, overwhelming_power(17), archive_of_the_titans(11)
0:53.027 default I hand_of_guldan Fluffy_Pillow 90902.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(15), archive_of_the_titans(11)
0:54.194 default J demonbolt Fluffy_Pillow 92069.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(14), archive_of_the_titans(11)
0:55.360 build_a_shard L shadow_bolt Fluffy_Pillow 91235.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(13), archive_of_the_titans(12)
0:56.923 default I hand_of_guldan Fluffy_Pillow 90798.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(12), archive_of_the_titans(12)
0:58.103 build_a_shard L shadow_bolt Fluffy_Pillow 91978.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(10), archive_of_the_titans(12)
0:59.684 default J demonbolt Fluffy_Pillow 91559.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(7), vilefiend, quick_navigation(2), overwhelming_power(9), archive_of_the_titans(12)
1:00.877 default B demonic_strength Fluffy_Pillow 90752.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(2), overwhelming_power(8), archive_of_the_titans(13)
1:02.079 default I hand_of_guldan Fluffy_Pillow 91954.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power(6), archive_of_the_titans(13)
1:03.287 default J demonbolt Fluffy_Pillow 93162.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), overwhelming_power(5), archive_of_the_titans(13)
1:04.502 build_a_shard L shadow_bolt Fluffy_Pillow 92377.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), overwhelming_power(4), archive_of_the_titans(13)
1:06.130 build_a_shard L shadow_bolt Fluffy_Pillow 92005.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), overwhelming_power(25), archive_of_the_titans(14)
1:07.578 default G call_dreadstalkers Fluffy_Pillow 91453.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(14)
1:08.665 default I hand_of_guldan Fluffy_Pillow 92540.0/100000: 93% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(14)
1:09.758 build_a_shard L shadow_bolt Fluffy_Pillow 93633.0/100000: 94% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(14)
1:11.220 build_a_shard L shadow_bolt Fluffy_Pillow 93095.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(15)
1:12.700 build_a_shard L shadow_bolt Fluffy_Pillow 92575.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(15)
1:14.188 default I hand_of_guldan Fluffy_Pillow 92063.0/100000: 92% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(15)
1:15.317 build_a_shard L shadow_bolt Fluffy_Pillow 93192.0/100000: 93% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(16)
1:16.829 build_a_shard L shadow_bolt Fluffy_Pillow 92704.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(16)
1:18.283 build_a_shard L shadow_bolt Fluffy_Pillow 92158.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(16)
1:19.753 default I hand_of_guldan Fluffy_Pillow 91628.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(16)
1:20.863 default J demonbolt Fluffy_Pillow 92738.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(17)
1:21.979 build_a_shard L shadow_bolt Fluffy_Pillow 91854.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(17)
1:23.474 default I hand_of_guldan Fluffy_Pillow 91349.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(17)
1:24.610 default J demonbolt Fluffy_Pillow 92485.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(17)
1:25.751 build_a_shard L shadow_bolt Fluffy_Pillow 91626.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(18)
1:27.281 build_a_shard L shadow_bolt Fluffy_Pillow 91156.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), overwhelming_power(4), archive_of_the_titans(18)
1:28.941 default G call_dreadstalkers Fluffy_Pillow 90816.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(6), quick_navigation, overwhelming_power(3), archive_of_the_titans(18)
1:30.601 default J demonbolt Fluffy_Pillow 92476.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power, archive_of_the_titans(19)
1:31.861 default I hand_of_guldan Fluffy_Pillow 91736.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(19)
1:33.131 default J demonbolt Fluffy_Pillow 93006.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:34.390 build_a_shard L shadow_bolt Fluffy_Pillow 92265.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:36.070 build_a_shard L shadow_bolt Fluffy_Pillow 91945.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
1:37.739 default F summon_vilefiend Fluffy_Pillow 91614.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
1:39.408 default H summon_demonic_tyrant Fluffy_Pillow 93283.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
1:41.078 default 8 potion Fluffy_Pillow 92953.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
1:41.078 default I hand_of_guldan Fluffy_Pillow 92953.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:42.332 build_a_shard L shadow_bolt Fluffy_Pillow 94207.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:44.001 build_a_shard L shadow_bolt Fluffy_Pillow 93876.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:45.672 default I hand_of_guldan Fluffy_Pillow 93547.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:46.918 build_a_shard L shadow_bolt Fluffy_Pillow 94793.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:48.503 build_a_shard L shadow_bolt Fluffy_Pillow 94378.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:50.086 build_a_shard L shadow_bolt Fluffy_Pillow 93961.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:51.668 default G call_dreadstalkers Fluffy_Pillow 93543.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:52.855 build_a_shard L shadow_bolt Fluffy_Pillow 94730.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:54.437 default I hand_of_guldan Fluffy_Pillow 94312.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:55.625 build_a_shard L shadow_bolt Fluffy_Pillow 95500.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(8), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:57.207 default J demonbolt Fluffy_Pillow 95082.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
1:58.483 default I hand_of_guldan Fluffy_Pillow 94358.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
1:59.759 default J demonbolt Fluffy_Pillow 95634.0/100000: 96% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:01.036 default B demonic_strength Fluffy_Pillow 94911.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:02.312 default E grimoire_felguard Fluffy_Pillow 96187.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:03.580 default J demonbolt Fluffy_Pillow 97455.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:04.848 default I hand_of_guldan Fluffy_Pillow 96723.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20), battle_potion_of_intellect
2:06.118 default J demonbolt Fluffy_Pillow 97993.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:07.387 default J demonbolt Fluffy_Pillow 97262.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
2:08.656 build_a_shard L shadow_bolt Fluffy_Pillow 96531.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:10.125 default I hand_of_guldan Fluffy_Pillow 96000.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(3), grimoire_felguard, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
2:11.241 default J demonbolt Fluffy_Pillow 97116.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(3), grimoire_felguard, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
2:12.364 default G call_dreadstalkers Fluffy_Pillow 96239.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), grimoire_felguard, quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
2:13.493 default I hand_of_guldan Fluffy_Pillow 97368.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, overwhelming_power(19), archive_of_the_titans(20)
2:14.626 build_a_shard L shadow_bolt Fluffy_Pillow 98501.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
2:16.147 default J demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
2:17.292 default I hand_of_guldan Fluffy_Pillow 97150.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
2:18.446 build_a_shard L shadow_bolt Fluffy_Pillow 98304.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
2:19.994 build_a_shard L shadow_bolt Fluffy_Pillow 97852.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(20)
2:21.551 build_a_shard L shadow_bolt Fluffy_Pillow 97409.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
2:23.125 build_a_shard L shadow_bolt Fluffy_Pillow 96983.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(20)
2:24.717 default F summon_vilefiend Fluffy_Pillow 96575.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(8), archive_of_the_titans(20)
2:26.318 default I hand_of_guldan Fluffy_Pillow 98176.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20)
2:27.532 default J demonbolt Fluffy_Pillow 99390.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(2), vilefiend, quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
2:28.746 default J demonbolt Fluffy_Pillow 98604.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps, vilefiend, quick_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
2:29.971 build_a_shard L shadow_bolt Fluffy_Pillow 97829.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
2:31.609 default I hand_of_guldan Fluffy_Pillow 97467.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
2:32.853 default G call_dreadstalkers Fluffy_Pillow 98711.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:34.107 build_a_shard L shadow_bolt Fluffy_Pillow 99965.0/100000: 100% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:35.777 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:37.435 default I hand_of_guldan Fluffy_Pillow 97663.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:38.622 default J demonbolt Fluffy_Pillow 98850.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:39.810 build_a_shard L shadow_bolt Fluffy_Pillow 98038.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:41.392 build_a_shard L shadow_bolt Fluffy_Pillow 97620.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:42.975 build_a_shard L shadow_bolt Fluffy_Pillow 97203.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:44.558 nether_portal_building b hand_of_guldan Fluffy_Pillow 96786.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
2:45.745 build_a_shard L shadow_bolt Fluffy_Pillow 97973.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:47.327 build_a_shard L shadow_bolt Fluffy_Pillow 97555.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation_final, archive_of_the_titans(20)
2:48.909 build_a_shard L shadow_bolt Fluffy_Pillow 97137.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(20)
2:50.609 nether_portal_building b hand_of_guldan Fluffy_Pillow 96837.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(20)
2:51.886 build_a_shard L shadow_bolt Fluffy_Pillow 98114.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), archive_of_the_titans(20)
2:53.588 nether_portal_building Z call_dreadstalkers Fluffy_Pillow 97816.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), archive_of_the_titans(20)
2:54.863 build_a_shard L shadow_bolt Fluffy_Pillow 99091.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
2:56.563 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
2:58.264 build_a_shard L shadow_bolt Fluffy_Pillow 97705.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
2:59.964 nether_portal_building b hand_of_guldan Fluffy_Pillow 97405.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:01.240 default B demonic_strength Fluffy_Pillow 98681.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
3:02.515 build_a_shard L shadow_bolt Fluffy_Pillow 99956.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps, dreadstalkers(2), archive_of_the_titans(20)
3:04.217 build_a_shard L shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:05.906 build_a_shard L shadow_bolt Fluffy_Pillow 97695.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
3:07.597 nether_portal_building Y nether_portal Fluffy_Pillow 97386.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, archive_of_the_titans(20)
3:08.866 nether_portal_active T hand_of_guldan Fluffy_Pillow 98655.0/100000: 99% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons, quick_navigation, archive_of_the_titans(20)
3:10.133 nether_portal_active T hand_of_guldan Fluffy_Pillow 99922.0/100000: 100% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons(2), quick_navigation(2), archive_of_the_titans(20)
3:11.393 nether_portal_active W demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(2), portal_summons(3), quick_navigation(2), archive_of_the_titans(20)
3:12.653 nether_portal_active Q summon_vilefiend Fluffy_Pillow 99260.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation(2), archive_of_the_titans(20)
3:14.332 nether_portal_active R call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), quick_navigation(3), archive_of_the_titans(20)
3:15.584 nether_portal_active U summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:17.254 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20)
3:17.254 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:17.254 nether_portal_active W demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:18.308 nether_portal_active T hand_of_guldan Fluffy_Pillow 97059.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:19.363 build_a_shard L shadow_bolt Fluffy_Pillow 98114.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:20.768 nether_portal_active T hand_of_guldan Fluffy_Pillow 97519.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(3), archive_of_the_titans(20), ignition_mages_fuse
3:21.822 build_a_shard L shadow_bolt Fluffy_Pillow 98573.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), archive_of_the_titans(20), ignition_mages_fuse(2)
3:23.176 nether_portal_active T hand_of_guldan Fluffy_Pillow 97927.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(2)
3:24.065 build_a_shard L shadow_bolt Fluffy_Pillow 98816.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(2)
3:25.255 nether_portal_active T hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.129 build_a_shard L shadow_bolt Fluffy_Pillow 98878.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.298 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(3)
3:28.650 build_a_shard L shadow_bolt Fluffy_Pillow 97356.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20), ignition_mages_fuse(3)
3:30.008 default I hand_of_guldan Fluffy_Pillow 96714.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(4)
3:31.011 build_a_shard L shadow_bolt Fluffy_Pillow 97717.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(4)
3:32.354 default J demonbolt Fluffy_Pillow 97060.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(4)
3:33.367 build_a_shard L shadow_bolt Fluffy_Pillow 96073.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.686 default G call_dreadstalkers Fluffy_Pillow 95392.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.682 default I hand_of_guldan Fluffy_Pillow 96388.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, supreme_commander, wild_imps(10), dreadstalkers(4), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(5)
3:36.683 default J demonbolt Fluffy_Pillow 97389.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse(5)
3:37.687 build_a_shard L shadow_bolt Fluffy_Pillow 96393.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(11), archive_of_the_titans(20)
3:39.243 default I hand_of_guldan Fluffy_Pillow 95949.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20)
3:40.424 build_a_shard L shadow_bolt Fluffy_Pillow 97130.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_calling, supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(8), archive_of_the_titans(20)
3:42.005 default J demonbolt Fluffy_Pillow 96711.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(6), archive_of_the_titans(20)
3:43.206 default I hand_of_guldan Fluffy_Pillow 95912.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(5), archive_of_the_titans(20)
3:44.415 default J demonbolt Fluffy_Pillow 97121.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
3:45.577 build_a_shard L shadow_bolt Fluffy_Pillow 96283.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
3:47.130 default I hand_of_guldan Fluffy_Pillow 95836.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(6), quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
3:48.311 default J demonbolt Fluffy_Pillow 97017.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
3:49.498 default J demonbolt Fluffy_Pillow 96204.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
3:50.686 build_a_shard L shadow_bolt Fluffy_Pillow 95392.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
3:52.270 default I hand_of_guldan Fluffy_Pillow 94976.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation_final, archive_of_the_titans(20)
3:53.458 default J demonbolt Fluffy_Pillow 96164.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), quick_navigation_final, archive_of_the_titans(20)
3:54.645 default G call_dreadstalkers Fluffy_Pillow 95351.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), archive_of_the_titans(20)
3:55.959 default I hand_of_guldan Fluffy_Pillow 96665.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:57.236 build_a_shard L shadow_bolt Fluffy_Pillow 97942.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
3:58.936 build_a_shard L shadow_bolt Fluffy_Pillow 97642.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:00.637 default F summon_vilefiend Fluffy_Pillow 97343.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), archive_of_the_titans(20)
4:02.337 default B demonic_strength Fluffy_Pillow 99043.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:03.614 default E grimoire_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
4:04.890 build_a_shard L shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, archive_of_the_titans(20)
4:06.591 build_a_shard L shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:08.281 default J demonbolt Fluffy_Pillow 97695.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:09.549 default I hand_of_guldan Fluffy_Pillow 96963.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, vilefiend, grimoire_felguard, quick_navigation, archive_of_the_titans(20)
4:10.818 default J demonbolt Fluffy_Pillow 98232.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:11.914 build_a_shard L shadow_bolt Fluffy_Pillow 97328.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
4:13.385 build_a_shard L shadow_bolt Fluffy_Pillow 96799.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
4:14.872 default G call_dreadstalkers Fluffy_Pillow 96286.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
4:15.996 default I hand_of_guldan Fluffy_Pillow 97410.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
4:17.124 build_a_shard L shadow_bolt Fluffy_Pillow 98538.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
4:18.643 build_a_shard L shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(17), archive_of_the_titans(20)
4:20.173 default I hand_of_guldan Fluffy_Pillow 97533.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(15), archive_of_the_titans(20)
4:21.332 build_a_shard L shadow_bolt Fluffy_Pillow 98692.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(14), archive_of_the_titans(20)
4:22.886 build_a_shard L shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(13), archive_of_the_titans(20)
4:24.449 build_a_shard L shadow_bolt Fluffy_Pillow 97566.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(11), archive_of_the_titans(20)
4:26.030 default I hand_of_guldan Fluffy_Pillow 97147.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(9), archive_of_the_titans(20)
4:27.230 build_a_shard L shadow_bolt Fluffy_Pillow 98347.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
4:28.842 build_a_shard L shadow_bolt Fluffy_Pillow 97959.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20)
4:30.453 build_a_shard L shadow_bolt Fluffy_Pillow 97570.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
4:32.082 build_a_shard L shadow_bolt Fluffy_Pillow 97199.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20)
4:33.731 build_a_shard L shadow_bolt Fluffy_Pillow 96848.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
4:35.390 default I hand_of_guldan Fluffy_Pillow 96507.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:36.649 default J demonbolt Fluffy_Pillow 97766.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation(2), archive_of_the_titans(20)
4:37.909 build_a_shard L shadow_bolt Fluffy_Pillow 97026.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps, quick_navigation(2), archive_of_the_titans(20)
4:39.588 default G call_dreadstalkers Fluffy_Pillow 96705.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:40.848 default I hand_of_guldan Fluffy_Pillow 97965.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:42.108 default J demonbolt Fluffy_Pillow 99225.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
4:43.199 default I hand_of_guldan Fluffy_Pillow 98316.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
4:44.299 build_a_shard L shadow_bolt Fluffy_Pillow 99416.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
4:45.770 build_a_shard L shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:47.250 default F summon_vilefiend Fluffy_Pillow 97484.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(20), archive_of_the_titans(20)
4:48.820 default H summon_demonic_tyrant Fluffy_Pillow 99054.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20)
4:50.315 default J demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20)
4:51.451 default I hand_of_guldan Fluffy_Pillow 97140.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
4:52.592 build_a_shard L shadow_bolt Fluffy_Pillow 98281.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
4:54.121 build_a_shard L shadow_bolt Fluffy_Pillow 97810.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
4:55.668 build_a_shard L shadow_bolt Fluffy_Pillow 97357.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20)
4:57.214 build_a_shard L shadow_bolt Fluffy_Pillow 96903.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(10), archive_of_the_titans(20)
4:58.779 build_a_shard L shadow_bolt Fluffy_Pillow 96468.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_GF_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DStr_GF_Imp : 17095 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17095.2 17095.2 16.0 / 0.094% 2286.5 / 13.4% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
963.4 954.4 Mana 0.00% 47.3 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Grimoire: Felguard (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_GF_Imp 17095
Demonbolt 1251 7.3% 44.1 6.22sec 8518 7485 Direct 44.9 7110 14223 8358 17.5%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.08 44.92 0.00 0.00 1.1381 0.0000 375438.41 375438.41 0.00 7484.67 7484.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.04 82.46% 7110.49 6520 8308 7111.37 6912 7323 263404 263404 0.00
crit 7.88 17.54% 14222.81 13040 16616 14212.99 0 16616 112034 112034 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1051 6.2% 60.4 4.90sec 5220 4738 Direct 60.3 4446 8903 5230 17.6%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.40 60.29 0.00 0.00 1.1017 0.0000 315309.51 315309.51 0.00 4738.08 4738.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.68 82.41% 4446.40 1634 5979 4440.11 3984 4828 220909 220909 0.00
crit 10.60 17.59% 8903.03 3267 11958 8891.04 5148 11120 94400 94400 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (202) 0.8% (1.2%) 7.3 37.13sec 8284 0 Direct 7.3 4925 9849 5795 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.30 0.00 0.00 0.0000 0.0000 42328.69 42328.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.31% 4924.62 4925 4925 4923.64 0 4925 29605 29605 0.00
crit 1.29 17.69% 9849.24 9849 9849 7291.87 0 9849 12724 12724 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 61 0.4% 7.3 37.13sec 2488 0 Direct 7.3 2111 4221 2488 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.30 0.00 0.00 0.0000 0.0000 18169.58 18169.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.00 82.13% 2110.55 2111 2111 2109.29 0 2111 12659 12659 0.00
crit 1.31 17.87% 4221.10 4221 4221 3137.75 0 4221 5510 5510 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1342 7.9% 95.8 3.05sec 4199 2811 Direct 95.1 3595 7189 4229 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.82 95.13 0.00 0.00 1.4938 0.0000 402319.06 402319.06 0.00 2810.71 2810.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.34 82.35% 3594.78 3373 4297 3595.36 3556 3653 281602 281602 0.00
crit 16.79 17.65% 7189.26 6745 8595 7190.65 6920 7560 120717 120717 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 290 1.7% 7.3 37.25sec 11917 0 Direct 7.2 10240 20481 12081 18.0%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.30 7.21 0.00 0.00 0.0000 0.0000 87040.67 87040.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.91 82.03% 10240.44 10240 10240 10234.29 0 10240 60525 60525 0.00
crit 1.29 17.97% 20480.88 20481 20481 15076.94 0 20481 26516 26516 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3147 / 3147
Firebolt 3147 18.4% 103.9 2.89sec 9080 6948 Direct 103.0 7775 15550 9152 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.86 103.04 0.00 0.00 1.3068 0.0000 943024.56 943024.56 0.00 6948.21 6948.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.80 82.30% 7775.30 7027 9401 7776.50 7641 7931 659343 659343 0.00
crit 18.24 17.70% 15549.51 14053 18802 15551.36 14209 16740 283682 283682 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - grimoire_felguard 4767 / 1032
Felstorm 652 0.8% 3.9 80.63sec 10652 3635 Periodic 19.5 1830 3660 2154 17.7% 3.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 19.47 19.47 2.9303 0.5925 41937.61 59954.84 30.05 3635.37 3635.37
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.0 82.28% 1829.65 1715 2197 1830.27 1767 2026 29312 41905 30.05
crit 3.4 17.72% 3660.47 3430 4393 3589.40 0 4393 12626 18050 29.46
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 1851 2.3% 18.5 13.89sec 6455 6456 Direct 18.5 5477 10969 6455 17.8%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.46 18.46 0.00 0.00 1.0000 0.0000 119140.38 170325.48 30.05 6455.72 6455.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.17 82.19% 5476.93 5020 6430 5479.31 5230 5886 83074 118765 30.05
crit 3.29 17.81% 10969.25 10040 12861 10682.91 0 12381 36066 51561 29.25
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2264 2.8% 41.0 6.36sec 3555 3007 Direct 41.0 3021 6040 3555 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.97 40.97 0.00 0.00 1.1821 0.0000 145639.25 208208.80 30.05 3007.15 3007.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.73 82.32% 3020.74 2744 3515 3021.58 2905 3224 101883 145655 30.05
crit 7.24 17.68% 6039.98 5488 7030 6038.27 0 6694 43756 62554 30.03
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - vicious_hellhound 1062 / 144
Demon Fangs 655 0.5% 9.3 12.46sec 2815 2815 Direct 9.3 2393 4780 2815 17.7%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.34 9.34 0.00 0.00 1.0000 0.0000 26302.31 26302.31 0.00 2814.89 2814.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.69 82.34% 2392.95 2116 2582 2391.72 0 2582 18412 18412 0.00
crit 1.65 17.66% 4780.36 4233 5163 3600.62 0 5163 7890 7890 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 407 0.3% 82.9 1.35sec 196 326 Direct 82.9 167 333 196 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.89 82.89 0.00 0.00 0.6010 0.0000 16228.54 23200.64 30.05 325.75 325.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.30 82.40% 166.51 147 179 166.65 147 178 11373 16259 30.05
crit 14.59 17.60% 332.84 294 358 332.99 0 358 4856 6942 30.04
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - darkhound 1309 / 177
Fel Bite 470 0.4% 9.0 13.18sec 2107 2107 Direct 9.0 1795 3590 2107 17.4%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.98 8.98 0.00 0.00 1.0000 0.0000 18924.06 27054.22 30.05 2107.36 2107.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 82.58% 1794.60 1586 1935 1793.22 0 1935 13309 19027 29.96
crit 1.56 17.42% 3590.02 3172 3870 2682.23 0 3870 5615 8027 22.44
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 840 0.7% 42.8 2.66sec 782 665 Direct 42.8 665 1330 782 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.84 42.84 0.00 0.00 1.1771 0.0000 33511.39 47908.55 30.05 664.54 664.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.27 82.34% 664.72 587 717 665.39 587 714 23447 33521 30.05
crit 7.57 17.66% 1329.90 1175 1433 1313.03 0 1433 10064 14388 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3206 / 1516
Bile Spit 1166 3.2% 6.8 47.24sec 24245 0 Direct 6.8 8928 17849 10475 17.3%  
Periodic 33.2 2822 0 2822 0.0% 22.1%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 6.77 33.16 33.16 0.0000 2.0000 164485.30 164485.30 0.00 2480.40 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.60 82.66% 8928.29 8474 10104 8927.46 8505 9547 49965 49965 0.00
crit 1.17 17.34% 17848.88 16947 20207 12994.76 0 20207 20952 20952 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.2 100.00% 2821.98 2502 3310 2822.77 2633 2885 93568 93568 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.0% 28.5 10.27sec 3653 3653 Direct 28.5 3105 6214 3653 17.6%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.51 28.51 0.00 0.00 1.0000 0.0000 104155.99 148903.49 30.05 3652.80 3652.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.49 82.39% 3105.29 2737 3621 3106.73 2902 3258 72951 104292 30.05
crit 5.02 17.61% 6213.66 5474 7243 6189.94 0 7243 31205 44612 29.92
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1306 3.6% 102.9 2.82sec 1801 1354 Direct 102.9 1530 3063 1801 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.86 102.86 0.00 0.00 1.3303 0.0000 185208.83 264778.26 30.05 1353.58 1353.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.72 82.37% 1530.45 1337 1775 1531.04 1463 1573 129657 185360 30.05
crit 18.14 17.63% 3062.75 2673 3550 3064.07 2806 3310 55552 79418 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3375 / 2231
Dreadbite 1069 4.1% 29.1 20.94sec 7275 0 Direct 29.1 6173 12358 7275 17.8%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.10 29.10 0.00 0.00 0.0000 0.0000 211672.86 211672.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.92 82.19% 6173.50 5711 7613 6173.94 5954 6371 147643 147643 0.00
crit 5.18 17.81% 12357.77 11423 15227 12290.09 0 15227 64030 64030 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2307 8.9% 312.4 1.89sec 1464 1106 Direct 312.4 1244 2488 1464 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 312.37 312.37 0.00 0.00 1.3233 0.0000 457244.26 653685.58 30.05 1106.18 1106.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.11 82.31% 1243.73 1101 1473 1243.90 1226 1263 319779 457162 30.05
crit 55.26 17.69% 2487.65 2203 2947 2488.24 2368 2617 137465 196523 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - shivarra 1956 / 264
melee 845 0.7% 42.9 2.63sec 783 666 Direct 42.9 665 1330 783 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.90 42.90 0.00 0.00 1.1764 0.0000 33587.85 48017.87 30.05 665.54 665.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.29 82.25% 664.83 587 717 665.35 587 714 23459 33537 30.05
crit 7.62 17.75% 1329.91 1175 1433 1316.98 0 1433 10129 14481 29.73
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 422 0.3% 42.9 2.63sec 391 315 Direct 42.9 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.90 42.90 0.00 0.00 1.2435 0.0000 16780.92 23990.34 30.05 314.56 314.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.32 82.34% 332.42 294 358 332.70 294 357 11742 16787 30.05
crit 7.58 17.66% 664.86 587 717 656.33 0 717 5039 7203 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (93) 0.0% (0.5%) 0.0 0.00sec 0 3975

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3974.51 3974.51
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 172 0.1% 6.9 17.57sec 993 0 Direct 6.9 844 1687 993 17.7%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.0000 0.0000 6885.20 9843.22 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.71 82.34% 844.17 749 914 843.01 0 914 4819 6890 29.97
crit 1.22 17.66% 1687.22 1498 1827 1144.13 0 1827 2066 2954 20.38
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 172 0.1% 6.9 17.57sec 991 0 Direct 6.9 844 1688 991 17.5%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.0000 0.0000 6873.85 9827.00 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.72 82.54% 844.08 749 914 840.45 0 914 4831 6906 29.88
crit 1.21 17.46% 1688.01 1498 1827 1146.27 0 1827 2043 2921 20.40
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 173 0.1% 6.9 17.57sec 995 0 Direct 6.9 844 1687 995 17.9%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.0000 0.0000 6898.45 9862.17 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.69 82.11% 844.16 749 914 840.12 0 914 4806 6871 29.86
crit 1.24 17.89% 1687.32 1498 1827 1150.25 0 1827 2092 2991 20.49
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 172 0.1% 6.9 17.57sec 995 0 Direct 6.9 844 1690 995 17.8%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 0.0000 0.0000 6897.74 9861.14 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.70 82.16% 843.84 749 914 841.54 0 914 4807 6872 29.93
crit 1.24 17.84% 1690.20 1498 1827 1148.40 0 1827 2091 2989 20.41
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - wild_imp 2575 / 2475
Fel Firebolt 2575 14.5% 994.5 0.29sec 746 502 Direct 990.3 637 1274 750 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 994.46 990.34 0.00 0.00 1.4871 0.0000 742358.87 742358.87 0.00 501.97 501.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 815.23 82.32% 636.96 569 761 636.98 626 649 519268 519268 0.00
crit 175.10 17.68% 1274.05 1138 1523 1274.07 1234 1313 223091 223091 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4667 / 824
Demonfire 4667 4.8% 37.8 6.90sec 6533 4894 Direct 37.7 5561 11124 6548 17.7%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.77 37.69 0.00 0.00 1.3348 0.0000 246760.22 246760.22 0.00 4894.00 4894.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.00 82.26% 5560.69 5312 5917 5563.96 5464 5674 172384 172384 0.00
crit 6.69 17.74% 11123.56 10624 11834 11124.18 0 11834 74376 74376 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1727 / 230
melee 840 0.6% 42.2 2.58sec 783 667 Direct 42.2 665 1329 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.16 42.16 0.00 0.00 1.1744 0.0000 33005.77 47185.71 30.05 666.66 666.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.67 82.25% 665.02 587 717 666.11 587 714 23059 32966 30.05
crit 7.48 17.75% 1329.29 1175 1433 1311.80 0 1433 9947 14220 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 420 0.3% 42.2 2.58sec 391 315 Direct 42.2 332 665 391 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.16 42.16 0.00 0.00 1.2416 0.0000 16491.46 23576.53 30.05 315.08 315.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.71 82.34% 332.49 294 358 333.03 294 357 11541 16499 30.05
crit 7.45 17.66% 664.83 587 717 655.39 0 717 4951 7077 29.58
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 468 0.4% 8.8 12.75sec 2111 2111 Direct 8.8 1795 3590 2111 17.6%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.79 8.79 0.00 0.00 1.0000 0.0000 18560.12 26533.92 30.05 2111.26 2111.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.24 82.38% 1794.85 1586 1935 1793.41 0 1935 12998 18583 29.95
crit 1.55 17.62% 3590.36 3172 3870 2665.72 0 3870 5562 7951 22.28
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3923 / 526
Toxic Bile 3923 3.0% 55.1 2.00sec 2825 3037 Direct 55.1 2401 4805 2825 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.05 55.05 0.00 0.00 0.9304 0.0000 155540.45 155540.45 0.00 3036.54 3036.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.34 82.36% 2401.21 2116 2582 2403.40 2116 2570 108869 108869 0.00
crit 9.71 17.64% 4804.82 4233 5163 4772.35 0 5163 46672 46672 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - urzul 1339 / 181
Many Faced Bite 500 0.4% 9.5 12.10sec 2115 2115 Direct 9.5 1792 3590 2115 17.9%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.48 9.48 0.00 0.00 1.0000 0.0000 20043.51 28654.60 30.05 2114.96 2114.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.78 82.07% 1792.31 1586 1935 1794.80 0 1935 13941 19930 30.04
crit 1.70 17.93% 3590.48 3172 3870 2774.53 0 3870 6103 8725 23.21
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 839 0.7% 42.7 2.62sec 783 666 Direct 42.7 665 1331 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.68 42.68 0.00 0.00 1.1758 0.0000 33410.37 47764.14 30.05 665.85 665.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.11 82.26% 664.81 587 717 665.58 587 714 23339 33366 30.05
crit 7.57 17.74% 1330.53 1175 1433 1311.79 0 1433 10071 14398 29.62
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - prince_malchezaar 4743 / 397
melee 3167 1.5% 21.0 1.50sec 3717 3168 Direct 21.0 3151 6310 3717 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.96 20.96 0.00 0.00 1.1733 0.0000 77924.89 111402.99 30.05 3168.32 3168.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.20 82.07% 3150.65 2784 3396 3157.78 2784 3383 54204 77491 30.05
crit 3.76 17.93% 6309.55 5567 6791 6050.65 0 6791 23721 33912 28.80
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1576 0.8% 21.0 1.50sec 1851 1491 Direct 21.0 1576 3148 1851 17.5%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.96 20.96 0.00 0.00 1.2417 0.0000 38799.46 55468.49 30.05 1490.68 1490.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.30 82.52% 1576.06 1392 1698 1579.34 1392 1691 27265 38978 30.05
crit 3.66 17.48% 3147.89 2784 3396 3028.99 0 3396 11535 16490 28.88
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - illidari_satyr 1278 / 171
melee 423 0.3% 42.6 2.63sec 391 333 Direct 42.6 332 665 391 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 1.1740 0.0000 16683.71 23851.37 30.05 333.23 333.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.11 82.32% 332.46 294 358 332.99 294 357 11671 16686 30.05
crit 7.54 17.68% 664.80 587 717 656.67 0 717 5012 7166 29.64
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 211 0.2% 42.6 2.63sec 195 157 Direct 42.6 166 332 195 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.65 42.65 0.00 0.00 1.2413 0.0000 8336.40 11917.88 30.05 157.49 157.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.14 82.40% 166.22 147 179 166.49 147 179 5841 8351 30.05
crit 7.50 17.60% 332.50 294 358 328.50 0 358 2495 3567 29.65
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 644 0.5% 9.1 12.70sec 2813 2813 Direct 9.1 2395 4790 2813 17.5%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.11 9.11 0.00 0.00 1.0000 0.0000 25628.46 25628.46 0.00 2812.91 2812.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.52 82.55% 2394.98 2116 2582 2394.06 0 2582 18013 18013 0.00
crit 1.59 17.45% 4789.68 4233 5163 3601.37 0 5163 7616 7616 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1840 / 244
Double Breath 0 (132) 0.0% (0.8%) 0.0 0.00sec 0 7420

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7420.36 7420.36
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 496 0.4% 7.0 17.22sec 2810 0 Direct 7.0 2390 4772 2810 17.6%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.97 6.97 0.00 0.00 0.0000 0.0000 19575.58 19575.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.74 82.37% 2390.15 2116 2582 2383.61 0 2582 13716 13716 0.00
crit 1.23 17.63% 4772.09 4233 5163 3200.41 0 5163 5860 5860 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 497 0.4% 7.0 17.22sec 2818 0 Direct 7.0 2390 4776 2818 18.0%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.97 6.97 0.00 0.00 0.0000 0.0000 19633.60 19633.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.72 82.04% 2389.75 2116 2582 2387.23 0 2582 13658 13658 0.00
crit 1.25 17.96% 4775.85 4233 5163 3246.19 0 5163 5976 5976 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 847 0.6% 42.4 2.65sec 783 667 Direct 42.4 665 1330 783 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.41 42.41 0.00 0.00 1.1734 0.0000 33196.76 47458.76 30.05 667.14 667.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.90 82.30% 665.11 587 717 666.06 587 714 23213 33186 30.05
crit 7.51 17.70% 1330.17 1175 1433 1314.54 0 1433 9984 14273 29.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - eye_of_guldan 988 / 81
Eye of Gul'dan 988 0.5% 27.7 4.17sec 870 1143 Periodic 60.2 400 0 400 0.0% 59.0%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.71 0.00 60.20 60.20 0.7608 2.9381 24101.45 24101.45 0.00 121.75 1143.28
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.2 100.00% 400.34 181 461 399.42 363 405 24101 24101 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
DStr_GF_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 187.29sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 20.94sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 0.00 0.00 0.00 1.2023 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_GF_Imp
  • harmful:false
  • if_expr:
 
Grimoire: Felguard 3.0 120.74sec

Stats details: grimoire_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.1279 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: grimoire_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard who attacks the target for {$s1=15} sec that deals {$216187s1=25}% increased damage. This Felguard will stun their target when summoned.
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2377 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.50sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.60 0.00 0.00 0.00 1.5115 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 15.1 14.67sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.13 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.24sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 0.00 0.00 1.5400 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 
pet - grimoire_felguard
Axe Toss 4.0 80.24sec

Stats details: axe_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: axe_toss

Static Values
  • id:89766
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89766
  • name:Axe Toss
  • school:physical
  • tooltip:Stunned for {$d=4 seconds}.
  • description:The $?s108499[Wrathguard][Felguard] hurls its weapon, stunning the target for {$89766d=4 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.0sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 187.3sec 187.3sec 6.76% 8.53% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.4 23.2sec 10.2sec 51.76% 83.60% 15.4(15.4) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.76%

Trigger Attempt Success

  • trigger_pct:20.01%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.4 29.9 12.4sec 5.3sec 38.50% 100.00% 4.3(4.3) 0.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:15.75%
  • demonic_core_2:15.69%
  • demonic_core_3:4.99%
  • demonic_core_4:2.07%

Trigger Attempt Success

  • trigger_pct:25.68%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.68% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.6sec 10.1sec 66.10% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.65%
  • dreadstalkers_4:6.45%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.1 0.4 180.7sec 1.7sec 1.17% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.18%

Trigger Attempt Success

  • trigger_pct:100.00%
grimoire_felguard 3.0 0.0 120.7sec 120.7sec 19.75% 0.00% 0.0(0.0) 2.9

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_grimoire_felguard
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_felguard_1:19.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.87% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.13%
  • ignition_mages_fuse_2:3.09%
  • ignition_mages_fuse_3:3.05%
  • ignition_mages_fuse_4:2.89%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.8sec 0.0sec 10.14% 18.25% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 67.0sec 36.6sec 44.05% 0.00% 3.0(41.3) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.47%
  • overwhelming_power_7:1.51%
  • overwhelming_power_8:1.55%
  • overwhelming_power_9:1.59%
  • overwhelming_power_10:1.63%
  • overwhelming_power_11:1.68%
  • overwhelming_power_12:1.72%
  • overwhelming_power_13:1.77%
  • overwhelming_power_14:1.82%
  • overwhelming_power_15:1.87%
  • overwhelming_power_16:1.92%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.03%
  • overwhelming_power_19:2.09%
  • overwhelming_power_20:2.15%
  • overwhelming_power_21:2.21%
  • overwhelming_power_22:2.27%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.1 182.8sec 14.7sec 19.60% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:2.01%
  • portal_summons_2:0.76%
  • portal_summons_3:1.26%
  • portal_summons_4:1.96%
  • portal_summons_5:1.38%
  • portal_summons_6:1.79%
  • portal_summons_7:4.30%
  • portal_summons_8:6.10%
  • portal_summons_9:0.05%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.1 0.0 182.6sec 90.2sec 1.16% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.3sec 67.52% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.70%
  • quick_navigation_2:17.12%
  • quick_navigation_3:16.58%
  • quick_navigation_4:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.4 0.0 52.2sec 52.2sec 17.53% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.4 0.1 82.6sec 80.0sec 17.07% 0.00% 0.1(0.1) 3.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.68% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 47.44% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:47.44%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 5.2 153.6 55.4sec 0.0sec 96.12% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:2.30%
  • wild_imps_2:2.74%
  • wild_imps_3:28.90%
  • wild_imps_4:7.66%
  • wild_imps_5:9.49%
  • wild_imps_6:26.04%
  • wild_imps_7:5.83%
  • wild_imps_8:4.00%
  • wild_imps_9:4.75%
  • wild_imps_10:1.52%
  • wild_imps_11:1.15%
  • wild_imps_12:1.08%
  • wild_imps_13:0.43%
  • wild_imps_14:0.16%
  • wild_imps_15:0.05%
  • wild_imps_16:0.01%
  • wild_imps_17:0.00%
  • wild_imps_18:0.00%
grimoire_felguard: Grimoire of Service 3.0 0.0 120.7sec 120.7sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_GF_Imp_grimoire_felguard
  • cooldown name:buff_grimoire_of_service
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • grimoire_of_service_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:216187
  • name:Grimoire of Service
  • tooltip:Summoned by a Grimoire of Service. Damage done increased by {$s1=25}%.
  • description:{$@spelldesc108501=Summons a second demon which fights for you for {$s1=25} sec and deals {$216187s1=25}% increased damage. 1.5 min cooldown. The demon will immmediately use one of its special abilities when summoned: $@spellname111859: Cleanses 1 harmful Magic effect from you. $@spellname111895 Taunts its target. $@spellname111896 Seduces its target. $@spellname111897 Interrupts its target.$?c2[ $@spellname111898 Stuns its target.][]}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_GF_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 15.1 13.9sec
one_shard_hog 8.9 21.8sec
two_shard_hog 3.8 16.6sec
three_shard_hog 47.7 5.8sec
portal_summon 15.1 13.9sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_GF_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 45.1 90143.9 2000.0 2045.2 4.2
grimoire_felguard Soul Shard 3.0 3.0 1.0 1.0 0.0
hand_of_guldan Soul Shard 60.4 159.7 2.6 2.6 1974.9
shadow_bolt Mana 95.8 191651.4 2000.0 2000.1 2.1
summon_demonic_tyrant Mana 3.6 7195.7 2000.0 2000.2 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.9 4154.5 40.0 40.0 227.0
pet - grimoire_felguard
felstorm Energy 3.9 236.2 60.0 60.0 177.5
legion_strike Energy 18.5 1107.4 60.0 60.0 107.6
pet - wild_imp
fel_firebolt Energy 994.4 15585.0 15.7 15.7 47.6
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 45.07 90.13 (48.47%) 2.00 0.02 0.02%
shadow_bolt Soul Shard 95.83 95.82 (51.53%) 1.00 0.00 0.00%
mana_regen Mana 554.66 286309.85 (100.00%) 516.19 13132.54 4.39%
pet - imp
energy_regen Energy 427.73 3983.63 (100.00%) 9.31 22.74 0.57%
pet - grimoire_felguard
energy_regen Energy 91.77 915.16 (100.00%) 9.97 48.41 5.02%
pet - demonic_tyrant
energy_regen Energy 37.78 0.00 (0.00%) 0.00 762.62 100.00%
pet - bilescourge
energy_regen Energy 15.12 0.00 (0.00%) 0.00 208.88 100.00%
pet - bilescourge
energy_regen Energy 11.98 0.00 (0.00%) 0.00 166.16 100.00%
pet - bilescourge
energy_regen Energy 6.92 0.00 (0.00%) 0.00 95.98 100.00%
pet - bilescourge
energy_regen Energy 11.90 0.00 (0.00%) 0.00 164.58 100.00%
pet - bilescourge
energy_regen Energy 5.61 0.00 (0.00%) 0.00 78.25 100.00%
Resource RPS-Gain RPS-Loss
Mana 954.41 963.35
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97302.16 93071.00 100000.00
Soul Shard 2.57 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.6%

Statistics & Data Analysis

Fight Length
Sample Data DStr_GF_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_GF_Imp Damage Per Second
Count 4999
Mean 17095.18
Minimum 15320.45
Maximum 19334.55
Spread ( max - min ) 4014.10
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 578.4185
5th Percentile 16204.59
95th Percentile 18126.62
( 95th Percentile - 5th Percentile ) 1922.03
Mean Distribution
Standard Deviation 8.1809
95.00% Confidence Intervall ( 17079.15 - 17111.22 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4398
0.1 Scale Factor Error with Delta=300 2857
0.05 Scale Factor Error with Delta=300 11425
0.01 Scale Factor Error with Delta=300 285607
Priority Target DPS
Sample Data DStr_GF_Imp Priority Target Damage Per Second
Count 4999
Mean 17095.18
Minimum 15320.45
Maximum 19334.55
Spread ( max - min ) 4014.10
Range [ ( max - min ) / 2 * 100% ] 11.74%
Standard Deviation 578.4185
5th Percentile 16204.59
95th Percentile 18126.62
( 95th Percentile - 5th Percentile ) 1922.03
Mean Distribution
Standard Deviation 8.1809
95.00% Confidence Intervall ( 17079.15 - 17111.22 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4398
0.1 Scale Factor Error with Delta=300 2857
0.05 Scale Factor Error with Delta=300 11425
0.01 Scale Factor Error with Delta=300 285607
DPS(e)
Sample Data DStr_GF_Imp Damage Per Second (Effective)
Count 4999
Mean 17095.18
Minimum 15320.45
Maximum 19334.55
Spread ( max - min ) 4014.10
Range [ ( max - min ) / 2 * 100% ] 11.74%
Damage
Sample Data DStr_GF_Imp Damage
Count 4999
Mean 1240605.91
Minimum 876289.89
Maximum 1639109.61
Spread ( max - min ) 762819.72
Range [ ( max - min ) / 2 * 100% ] 30.74%
DTPS
Sample Data DStr_GF_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_GF_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_GF_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_GF_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_GF_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_GF_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_GF_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_GF_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.38 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
D 1.98 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.81 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.59 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.63 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 44.45 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 40.29 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 96.35 shadow_bolt
actions.nether_portal_active
# count action,conditions
O 1.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
P 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Q 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
R 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
S 13.70 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
T 1.94 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
U 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
V 3.78 demonbolt,if=buff.demonic_core.up
W 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
X 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Y 1.02 call_dreadstalkers
Z 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
a 1.93 hand_of_guldan,if=soul_shard>=5
b 0.00 call_action_list,name=build_a_shard

Sample Sequence

012367XOPQST9AKSKSKSKSKSKSKKKKKFHIHKKKHIIHIHIIHKKKFIHKEIHKKHIIHIKKFHKKHIKHKKKHKKKKKFHIHIKEG8KHIKKKFHKKHIIHIHKDIIKHFIHKKKHKKKIEKHIFHKKKHKKKKKaKKYZKKKKKaKKKXSSVPQT9AVSKSKSKSKKKHKIKFIHKKHIIHKKHIIKHIFKEHKDKIHIIHIKKFHKKHKKKHIKKKHFIHIIKEGHIHIKKKFHK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_GF_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, battle_potion_of_intellect
0:00.000 nether_portal_building X nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_calling, archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active O grimoire_felguard Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, demonic_calling, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.259 nether_portal_active P summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, nether_portal, grimoire_felguard, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.566 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, nether_portal, vilefiend, grimoire_felguard, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:04.548 nether_portal_active S hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:05.531 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:06.838 default 9 use_items Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:06.838 default A berserking Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.838 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps, dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.937 nether_portal_active S hand_of_guldan Fluffy_Pillow 97102.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.763 build_a_shard K shadow_bolt Fluffy_Pillow 97928.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.864 nether_portal_active S hand_of_guldan Fluffy_Pillow 97029.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.690 build_a_shard K shadow_bolt Fluffy_Pillow 97855.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.791 nether_portal_active S hand_of_guldan Fluffy_Pillow 96956.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.590 build_a_shard K shadow_bolt Fluffy_Pillow 97755.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.656 nether_portal_active S hand_of_guldan Fluffy_Pillow 96821.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.457 build_a_shard K shadow_bolt Fluffy_Pillow 97622.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.523 nether_portal_active S hand_of_guldan Fluffy_Pillow 96688.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.300 build_a_shard K shadow_bolt Fluffy_Pillow 97465.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.333 nether_portal_active S hand_of_guldan Fluffy_Pillow 96498.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.226 build_a_shard K shadow_bolt Fluffy_Pillow 97391.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.412 build_a_shard K shadow_bolt Fluffy_Pillow 96577.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.565 build_a_shard K shadow_bolt Fluffy_Pillow 95730.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.716 build_a_shard K shadow_bolt Fluffy_Pillow 94881.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, grimoire_felguard, portal_summons(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.867 build_a_shard K shadow_bolt Fluffy_Pillow 94032.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.985 default F call_dreadstalkers Fluffy_Pillow 93150.0/100000: 93% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(5)
0:24.818 default H hand_of_guldan Fluffy_Pillow 93983.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(5)
0:25.652 default I demonbolt Fluffy_Pillow 94817.0/100000: 95% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.486 default H hand_of_guldan Fluffy_Pillow 93651.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.319 build_a_shard K shadow_bolt Fluffy_Pillow 94484.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(2), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(6)
0:28.611 build_a_shard K shadow_bolt Fluffy_Pillow 93776.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, grimoire_felguard, portal_summons(8), quick_navigation(2), archive_of_the_titans(6)
0:29.903 build_a_shard K shadow_bolt Fluffy_Pillow 93068.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(6)
0:31.198 default H hand_of_guldan Fluffy_Pillow 92363.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(2), archive_of_the_titans(7)
0:32.168 default I demonbolt Fluffy_Pillow 93333.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:33.137 default I demonbolt Fluffy_Pillow 92302.0/100000: 92% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:34.108 default H hand_of_guldan Fluffy_Pillow 91273.0/100000: 91% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(7)
0:35.078 default I demonbolt Fluffy_Pillow 92243.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(8)
0:36.048 default H hand_of_guldan Fluffy_Pillow 91213.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), demonic_calling, supreme_commander, wild_imps(3), quick_navigation(2), archive_of_the_titans(8)
0:37.017 default I demonbolt Fluffy_Pillow 92182.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(3), archive_of_the_titans(8)
0:37.981 default I demonbolt Fluffy_Pillow 91146.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core, demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(8)
0:38.945 default H hand_of_guldan Fluffy_Pillow 90110.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_calling, wild_imps(8), quick_navigation(3), archive_of_the_titans(8)
0:39.909 build_a_shard K shadow_bolt Fluffy_Pillow 91074.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_calling, wild_imps(8), quick_navigation(3), archive_of_the_titans(8)
0:41.193 build_a_shard K shadow_bolt Fluffy_Pillow 90358.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), quick_navigation(3), archive_of_the_titans(9)
0:42.862 build_a_shard K shadow_bolt Fluffy_Pillow 90027.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(9), quick_navigation(3), archive_of_the_titans(9)
0:44.533 default F call_dreadstalkers Fluffy_Pillow 89698.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(9)
0:45.785 default I demonbolt Fluffy_Pillow 90950.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:47.037 default H hand_of_guldan Fluffy_Pillow 90202.0/100000: 90% mana | 5.0/5: 100% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:48.289 build_a_shard K shadow_bolt Fluffy_Pillow 91454.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(25), archive_of_the_titans(10)
0:49.737 default E summon_vilefiend Fluffy_Pillow 90902.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(10)
0:51.185 default I demonbolt Fluffy_Pillow 92350.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(11)
0:52.284 default H hand_of_guldan Fluffy_Pillow 91449.0/100000: 91% mana | 4.0/5: 80% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(11)
0:53.389 build_a_shard K shadow_bolt Fluffy_Pillow 92554.0/100000: 93% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(11)
0:54.868 build_a_shard K shadow_bolt Fluffy_Pillow 92033.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(19), archive_of_the_titans(11)
0:56.355 default H hand_of_guldan Fluffy_Pillow 91520.0/100000: 92% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(17), archive_of_the_titans(12)
0:57.482 default I demonbolt Fluffy_Pillow 92647.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(16), archive_of_the_titans(12)
0:58.571 default I demonbolt Fluffy_Pillow 91736.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(12)
0:59.665 default H hand_of_guldan Fluffy_Pillow 90830.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(12)
1:00.763 default I demonbolt Fluffy_Pillow 91928.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(13), archive_of_the_titans(13)
1:01.867 build_a_shard K shadow_bolt Fluffy_Pillow 91032.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(12), archive_of_the_titans(13)
1:03.347 build_a_shard K shadow_bolt Fluffy_Pillow 90512.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(13)
1:04.729 default F call_dreadstalkers Fluffy_Pillow 89894.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, overwhelming_power(24), archive_of_the_titans(13)
1:05.771 default H hand_of_guldan Fluffy_Pillow 90936.0/100000: 91% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(14)
1:06.820 build_a_shard K shadow_bolt Fluffy_Pillow 91985.0/100000: 92% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(14)
1:08.222 build_a_shard K shadow_bolt Fluffy_Pillow 91387.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), overwhelming_power(25), archive_of_the_titans(14)
1:09.693 default H hand_of_guldan Fluffy_Pillow 90858.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(24), archive_of_the_titans(14)
1:10.798 default I demonbolt Fluffy_Pillow 91963.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(23), archive_of_the_titans(15)
1:11.909 build_a_shard K shadow_bolt Fluffy_Pillow 91074.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(22), archive_of_the_titans(15)
1:13.397 default H hand_of_guldan Fluffy_Pillow 90562.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(15)
1:14.520 build_a_shard K shadow_bolt Fluffy_Pillow 91685.0/100000: 92% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(15)
1:16.022 build_a_shard K shadow_bolt Fluffy_Pillow 91187.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(16)
1:17.543 build_a_shard K shadow_bolt Fluffy_Pillow 90708.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(16)
1:19.072 default H hand_of_guldan Fluffy_Pillow 90237.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(16)
1:20.234 build_a_shard K shadow_bolt Fluffy_Pillow 91399.0/100000: 91% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(13), archive_of_the_titans(17)
1:21.790 build_a_shard K shadow_bolt Fluffy_Pillow 90955.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(17)
1:23.353 build_a_shard K shadow_bolt Fluffy_Pillow 90518.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(17)
1:24.935 build_a_shard K shadow_bolt Fluffy_Pillow 90100.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(9), archive_of_the_titans(17)
1:26.528 build_a_shard K shadow_bolt Fluffy_Pillow 89693.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(7), archive_of_the_titans(18)
1:28.139 default F call_dreadstalkers Fluffy_Pillow 89304.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), overwhelming_power(5), archive_of_the_titans(18)
1:29.363 default H hand_of_guldan Fluffy_Pillow 90528.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(2), dreadstalkers(2), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(18)
1:30.594 default I demonbolt Fluffy_Pillow 91759.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), dreadstalkers(2), quick_navigation(2), overwhelming_power(3), archive_of_the_titans(19)
1:31.830 default H hand_of_guldan Fluffy_Pillow 90995.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps, dreadstalkers(2), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(19)
1:33.076 default I demonbolt Fluffy_Pillow 92241.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:34.336 build_a_shard K shadow_bolt Fluffy_Pillow 91501.0/100000: 92% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(19)
1:36.015 default E summon_vilefiend Fluffy_Pillow 91180.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
1:37.850 default G summon_demonic_tyrant Fluffy_Pillow 93015.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
1:39.518 default 8 potion Fluffy_Pillow 92683.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
1:39.518 build_a_shard K shadow_bolt Fluffy_Pillow 92683.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:41.188 default H hand_of_guldan Fluffy_Pillow 92353.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:42.434 default I demonbolt Fluffy_Pillow 93599.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:43.680 build_a_shard K shadow_bolt Fluffy_Pillow 92845.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:45.339 build_a_shard K shadow_bolt Fluffy_Pillow 92504.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:46.922 build_a_shard K shadow_bolt Fluffy_Pillow 92087.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:48.505 default F call_dreadstalkers Fluffy_Pillow 91670.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:49.692 default H hand_of_guldan Fluffy_Pillow 92857.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:50.879 build_a_shard K shadow_bolt Fluffy_Pillow 94044.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20), battle_potion_of_intellect
1:52.262 build_a_shard K shadow_bolt Fluffy_Pillow 93427.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20), battle_potion_of_intellect
1:53.658 default H hand_of_guldan Fluffy_Pillow 92823.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20), battle_potion_of_intellect
1:54.711 default I demonbolt Fluffy_Pillow 93876.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(21), archive_of_the_titans(20), battle_potion_of_intellect
1:55.770 default I demonbolt Fluffy_Pillow 92935.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(9), dreadstalkers(2), vilefiend, overwhelming_power(20), archive_of_the_titans(20), battle_potion_of_intellect
1:56.905 default H hand_of_guldan Fluffy_Pillow 92070.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, overwhelming_power(19), archive_of_the_titans(20), battle_potion_of_intellect
1:58.045 default I demonbolt Fluffy_Pillow 93210.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, overwhelming_power(17), archive_of_the_titans(20), battle_potion_of_intellect
1:59.199 default H hand_of_guldan Fluffy_Pillow 92364.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, overwhelming_power(16), archive_of_the_titans(20), battle_potion_of_intellect
2:00.361 build_a_shard K shadow_bolt Fluffy_Pillow 93526.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_calling, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, overwhelming_power(15), archive_of_the_titans(20), battle_potion_of_intellect
2:01.917 default D grimoire_felguard Fluffy_Pillow 93082.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(9), vilefiend, overwhelming_power(14), archive_of_the_titans(20), battle_potion_of_intellect
2:03.092 default I demonbolt Fluffy_Pillow 94257.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(9), vilefiend, grimoire_felguard, overwhelming_power(12), archive_of_the_titans(20), battle_potion_of_intellect
2:04.280 default I demonbolt Fluffy_Pillow 93445.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), vilefiend, grimoire_felguard, overwhelming_power(11), archive_of_the_titans(20), battle_potion_of_intellect
2:05.473 build_a_shard K shadow_bolt Fluffy_Pillow 92638.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), vilefiend, grimoire_felguard, overwhelming_power(10), archive_of_the_titans(20)
2:07.075 default H hand_of_guldan Fluffy_Pillow 92240.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(5), vilefiend, grimoire_felguard, overwhelming_power(8), archive_of_the_titans(20)
2:08.289 default F call_dreadstalkers Fluffy_Pillow 93454.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(3), grimoire_felguard, quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
2:09.603 default I demonbolt Fluffy_Pillow 94768.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
2:10.708 default H hand_of_guldan Fluffy_Pillow 93873.0/100000: 94% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation, overwhelming_power(23), archive_of_the_titans(20)
2:11.819 build_a_shard K shadow_bolt Fluffy_Pillow 94984.0/100000: 95% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
2:13.297 build_a_shard K shadow_bolt Fluffy_Pillow 94462.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
2:14.791 build_a_shard K shadow_bolt Fluffy_Pillow 93956.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
2:16.294 default H hand_of_guldan Fluffy_Pillow 93459.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), grimoire_felguard, quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
2:17.435 build_a_shard K shadow_bolt Fluffy_Pillow 94600.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(20)
2:18.965 build_a_shard K shadow_bolt Fluffy_Pillow 94130.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
2:20.494 build_a_shard K shadow_bolt Fluffy_Pillow 93659.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
2:22.040 default I demonbolt Fluffy_Pillow 93205.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
2:23.213 default E summon_vilefiend Fluffy_Pillow 92378.0/100000: 92% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
2:24.786 build_a_shard K shadow_bolt Fluffy_Pillow 93951.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
2:26.367 default H hand_of_guldan Fluffy_Pillow 93532.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(2), vilefiend, quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
2:27.568 default I demonbolt Fluffy_Pillow 94733.0/100000: 95% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, vilefiend, quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
2:28.777 default F call_dreadstalkers Fluffy_Pillow 93942.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps, vilefiend, quick_navigation(3), overwhelming_power(5), archive_of_the_titans(20)
2:29.993 default H hand_of_guldan Fluffy_Pillow 95158.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20)
2:31.208 build_a_shard K shadow_bolt Fluffy_Pillow 96373.0/100000: 96% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(2), archive_of_the_titans(20)
2:32.847 build_a_shard K shadow_bolt Fluffy_Pillow 96012.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power, archive_of_the_titans(20)
2:34.496 build_a_shard K shadow_bolt Fluffy_Pillow 95661.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:36.155 default H hand_of_guldan Fluffy_Pillow 95320.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:37.401 build_a_shard K shadow_bolt Fluffy_Pillow 96566.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:39.060 build_a_shard K shadow_bolt Fluffy_Pillow 96225.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:40.721 build_a_shard K shadow_bolt Fluffy_Pillow 95886.0/100000: 96% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:42.379 build_a_shard K shadow_bolt Fluffy_Pillow 95544.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:44.039 build_a_shard K shadow_bolt Fluffy_Pillow 95204.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:45.698 nether_portal_building a hand_of_guldan Fluffy_Pillow 94863.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation_final, archive_of_the_titans(20)
2:46.886 build_a_shard K shadow_bolt Fluffy_Pillow 96051.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation_final, archive_of_the_titans(20)
2:48.470 build_a_shard K shadow_bolt Fluffy_Pillow 95635.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(20)
2:49.852 nether_portal_building Y call_dreadstalkers Fluffy_Pillow 95017.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(20)
2:50.895 nether_portal_building Z hand_of_guldan Fluffy_Pillow 96060.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
2:51.942 build_a_shard K shadow_bolt Fluffy_Pillow 97107.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
2:53.345 build_a_shard K shadow_bolt Fluffy_Pillow 96510.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
2:54.764 build_a_shard K shadow_bolt Fluffy_Pillow 95929.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
2:56.189 build_a_shard K shadow_bolt Fluffy_Pillow 95354.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), overwhelming_power(17), archive_of_the_titans(20)
2:57.726 build_a_shard K shadow_bolt Fluffy_Pillow 94891.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), overwhelming_power(16), archive_of_the_titans(20)
2:59.272 nether_portal_building a hand_of_guldan Fluffy_Pillow 94437.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), overwhelming_power(14), archive_of_the_titans(20)
3:00.446 build_a_shard K shadow_bolt Fluffy_Pillow 95611.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), dreadstalkers(2), overwhelming_power(13), archive_of_the_titans(20)
3:02.020 build_a_shard K shadow_bolt Fluffy_Pillow 95185.0/100000: 95% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(2), overwhelming_power(11), archive_of_the_titans(20)
3:03.611 build_a_shard K shadow_bolt Fluffy_Pillow 94776.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), overwhelming_power(10), archive_of_the_titans(20)
3:05.212 nether_portal_building X nether_portal Fluffy_Pillow 94377.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
3:06.420 nether_portal_active S hand_of_guldan Fluffy_Pillow 95585.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons, quick_navigation, overwhelming_power(7), archive_of_the_titans(20)
3:07.636 nether_portal_active S hand_of_guldan Fluffy_Pillow 96801.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons(2), quick_navigation, overwhelming_power(6), archive_of_the_titans(20)
3:08.860 nether_portal_active V demonbolt Fluffy_Pillow 98025.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(4), portal_summons(3), quick_navigation, overwhelming_power(5), archive_of_the_titans(20)
3:10.089 nether_portal_active P summon_vilefiend Fluffy_Pillow 97254.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), portal_summons(3), quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
3:11.748 nether_portal_active Q call_dreadstalkers Fluffy_Pillow 98913.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
3:12.993 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation(2), overwhelming_power, archive_of_the_titans(20)
3:14.662 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(20)
3:14.662 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:14.662 nether_portal_active V demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:15.722 nether_portal_active S hand_of_guldan Fluffy_Pillow 97064.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:16.783 build_a_shard K shadow_bolt Fluffy_Pillow 98125.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:18.196 nether_portal_active S hand_of_guldan Fluffy_Pillow 97538.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse
3:19.257 build_a_shard K shadow_bolt Fluffy_Pillow 98599.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.624 nether_portal_active S hand_of_guldan Fluffy_Pillow 97966.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.522 build_a_shard K shadow_bolt Fluffy_Pillow 98864.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.717 nether_portal_active S hand_of_guldan Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.594 build_a_shard K shadow_bolt Fluffy_Pillow 98880.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.769 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(21), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.128 build_a_shard K shadow_bolt Fluffy_Pillow 97363.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse(3)
3:27.499 default H hand_of_guldan Fluffy_Pillow 96734.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.505 build_a_shard K shadow_bolt Fluffy_Pillow 97740.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation(3), overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.854 default I demonbolt Fluffy_Pillow 97089.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.871 build_a_shard K shadow_bolt Fluffy_Pillow 96106.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(13), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(5)
3:32.196 default F call_dreadstalkers Fluffy_Pillow 95431.0/100000: 95% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, portal_summons(7), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.533 default I demonbolt Fluffy_Pillow 96768.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, portal_summons(7), quick_navigation(4), overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.537 default H hand_of_guldan Fluffy_Pillow 95772.0/100000: 96% mana | 4.0/5: 80% soul_shard supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, quick_navigation(4), overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse(5)
3:35.546 build_a_shard K shadow_bolt Fluffy_Pillow 96781.0/100000: 97% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
3:37.039 build_a_shard K shadow_bolt Fluffy_Pillow 96274.0/100000: 96% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
3:38.550 default H hand_of_guldan Fluffy_Pillow 95785.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
3:39.691 default I demonbolt Fluffy_Pillow 96926.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
3:40.838 default I demonbolt Fluffy_Pillow 96073.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
3:41.992 default H hand_of_guldan Fluffy_Pillow 95227.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
3:43.150 build_a_shard K shadow_bolt Fluffy_Pillow 96385.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_calling, supreme_commander, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
3:44.714 build_a_shard K shadow_bolt Fluffy_Pillow 95949.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power, archive_of_the_titans(20)
3:46.286 default H hand_of_guldan Fluffy_Pillow 95521.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(20)
3:47.562 default I demonbolt Fluffy_Pillow 96797.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:48.830 default I demonbolt Fluffy_Pillow 96065.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:50.099 build_a_shard K shadow_bolt Fluffy_Pillow 95334.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:51.789 default H hand_of_guldan Fluffy_Pillow 95024.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
3:53.055 default I demonbolt Fluffy_Pillow 96290.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), quick_navigation, archive_of_the_titans(20)
3:54.324 default F call_dreadstalkers Fluffy_Pillow 95559.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), quick_navigation, archive_of_the_titans(20)
3:55.592 build_a_shard K shadow_bolt Fluffy_Pillow 96827.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
3:57.281 default E summon_vilefiend Fluffy_Pillow 96516.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
3:58.962 default H hand_of_guldan Fluffy_Pillow 98197.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
4:00.223 build_a_shard K shadow_bolt Fluffy_Pillow 99458.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:01.892 default D grimoire_felguard Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
4:03.168 build_a_shard K shadow_bolt Fluffy_Pillow 99280.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(3), archive_of_the_titans(20)
4:04.837 default I demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:06.082 default H hand_of_guldan Fluffy_Pillow 97249.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, grimoire_felguard, quick_navigation(4), archive_of_the_titans(20)
4:07.328 default I demonbolt Fluffy_Pillow 98495.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:08.513 default I demonbolt Fluffy_Pillow 97680.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:09.700 default H hand_of_guldan Fluffy_Pillow 96867.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:10.886 default I demonbolt Fluffy_Pillow 98053.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:12.073 build_a_shard K shadow_bolt Fluffy_Pillow 97240.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:13.656 build_a_shard K shadow_bolt Fluffy_Pillow 96823.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:15.239 default F call_dreadstalkers Fluffy_Pillow 96406.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(6), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:16.426 default H hand_of_guldan Fluffy_Pillow 97593.0/100000: 98% mana | 4.0/5: 80% soul_shard wild_imps(5), dreadstalkers(2), grimoire_felguard, quick_navigation_final, archive_of_the_titans(20)
4:17.612 build_a_shard K shadow_bolt Fluffy_Pillow 98779.0/100000: 99% mana | 1.0/5: 20% soul_shard wild_imps(3), dreadstalkers(2), archive_of_the_titans(20)
4:19.313 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), archive_of_the_titans(20)
4:21.013 default H hand_of_guldan Fluffy_Pillow 97705.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:22.279 build_a_shard K shadow_bolt Fluffy_Pillow 98971.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(3), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:23.968 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:25.658 build_a_shard K shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:27.347 default H hand_of_guldan Fluffy_Pillow 97383.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation, archive_of_the_titans(20)
4:28.616 default I demonbolt Fluffy_Pillow 98652.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:29.878 build_a_shard K shadow_bolt Fluffy_Pillow 97914.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
4:31.557 build_a_shard K shadow_bolt Fluffy_Pillow 97593.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(2), archive_of_the_titans(20)
4:33.237 build_a_shard K shadow_bolt Fluffy_Pillow 97273.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:34.918 default H hand_of_guldan Fluffy_Pillow 96954.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:36.179 default F call_dreadstalkers Fluffy_Pillow 98215.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:37.441 default I demonbolt Fluffy_Pillow 99477.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:38.699 default H hand_of_guldan Fluffy_Pillow 98735.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
4:39.960 default I demonbolt Fluffy_Pillow 99996.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:41.211 default I demonbolt Fluffy_Pillow 99247.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:42.462 build_a_shard K shadow_bolt Fluffy_Pillow 98498.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
4:44.132 default E summon_vilefiend Fluffy_Pillow 98005.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
4:45.791 default G summon_demonic_tyrant Fluffy_Pillow 99664.0/100000: 100% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:47.450 default H hand_of_guldan Fluffy_Pillow 98004.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:48.696 default I demonbolt Fluffy_Pillow 99250.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_power, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:49.943 default H hand_of_guldan Fluffy_Pillow 98497.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20)
4:51.188 default I demonbolt Fluffy_Pillow 99742.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
4:52.269 build_a_shard K shadow_bolt Fluffy_Pillow 98823.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
4:53.718 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
4:55.159 build_a_shard K shadow_bolt Fluffy_Pillow 97446.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
4:56.614 default F call_dreadstalkers Fluffy_Pillow 96901.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
4:57.713 default H hand_of_guldan Fluffy_Pillow 98000.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
4:58.816 build_a_shard K shadow_bolt Fluffy_Pillow 99103.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_GF_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103033

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

DStr_ID_Felguard : 17485 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17484.6 17484.6 15.5 / 0.089% 2168.8 / 12.4% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
947.9 939.5 Mana 0.00% 47.6 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_ID_Felguard 17485
Demonbolt 1317 7.6% 46.4 5.89sec 8519 7493 Direct 47.2 7110 14216 8369 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.40 47.23 0.00 0.00 1.1370 0.0000 395262.69 395262.69 0.00 7492.85 7492.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.86 82.29% 7110.36 6520 8308 7111.91 6910 7350 276339 276339 0.00
crit 8.37 17.71% 14215.55 13040 16616 14218.52 0 16616 118924 118924 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1072 6.1% 61.7 4.79sec 5213 4734 Direct 61.6 4439 8863 5224 17.7%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.71 61.59 0.00 0.00 1.1012 0.0000 321711.37 321711.37 0.00 4734.11 4734.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.66 82.26% 4438.98 1634 5979 4432.92 4008 4797 224895 224895 0.00
crit 10.92 17.74% 8863.42 3267 11958 8849.21 5064 10892 96817 96817 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 140 (200) 0.8% (1.1%) 7.3 36.84sec 8264 0 Direct 7.3 4925 9849 5773 17.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.26 7.26 0.00 0.00 0.0000 0.0000 41936.61 41936.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.01 82.78% 4924.62 4925 4925 4924.62 4925 4925 29613 29613 0.00
crit 1.25 17.22% 9849.24 9849 9849 7073.17 0 9849 12324 12324 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.3% 7.3 36.84sec 2491 0 Direct 7.3 2111 4221 2491 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.26 7.26 0.00 0.00 0.0000 0.0000 18096.11 18096.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.95 81.97% 2110.55 2111 2111 2109.29 0 2111 12568 12568 0.00
crit 1.31 18.03% 4221.10 4221 4221 3105.67 0 4221 5528 5528 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1276 7.3% 91.2 3.21sec 4195 2812 Direct 90.6 3590 7180 4224 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.22 90.58 0.00 0.00 1.4916 0.0000 382627.77 382627.77 0.00 2812.34 2812.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.57 82.33% 3589.93 3335 4297 3590.50 3543 3649 267717 267717 0.00
crit 16.00 17.67% 7180.15 6670 8595 7181.50 6935 7635 114911 114911 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 291 1.7% 7.3 36.48sec 11908 0 Direct 7.2 10240 20481 12074 17.9%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.33 7.23 0.00 0.00 0.0000 0.0000 87268.05 87268.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.93 82.09% 10240.44 10240 10240 10238.39 0 10240 60760 60760 0.00
crit 1.29 17.91% 20480.88 20481 20481 15007.29 0 20481 26508 26508 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - felguard 3734 / 3734
(demonic_strength_) Felstorm 796 4.6% 5.4 60.69sec 43907 11460 Periodic 32.4 6259 12522 7364 17.6% 6.9%

Stats details: demonic_strength_felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 0.00 32.36 32.36 3.8314 0.6426 238320.80 340708.20 30.05 11459.93 11459.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.7 82.36% 6259.02 5816 7641 6256.30 6041 6545 166816 238483 30.05
crit 5.7 17.64% 12522.31 11633 15282 12486.72 0 15282 71505 102225 29.98
 
 

Action details: demonic_strength_felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Felstorm 367 2.1% 10.2 30.58sec 10838 2863 Periodic 60.6 1545 3090 1818 17.7% 12.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.17 0.00 60.63 60.63 3.7860 0.6351 110226.47 157581.98 30.05 2862.58 2862.58
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.9 82.33% 1544.93 1428 1910 1544.94 1520 1587 77126 110261 30.05
crit 10.7 17.67% 3090.39 2908 3820 3090.41 2937 3591 33100 47321 30.05
 
 

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $ Physical damage every $t1 sec. Unable to use other abilities.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:
  • description:{$@spelldesc89751=The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $<damage> Physical damage every $t1 sec for {$89751d=5 seconds}. The Felguard cannot take any other action during Felstorm.}
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
Legion Strike 968 5.5% 53.2 5.52sec 5448 5424 Direct 53.2 4634 9266 5449 17.6%  

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.23 53.23 0.00 0.00 1.0045 0.0000 289993.71 414580.84 30.05 5424.09 5424.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.87 82.42% 4633.95 4179 5592 4634.92 4515 4774 203276 290607 30.05
crit 9.36 17.58% 9266.07 8359 11183 9268.44 8575 10578 86718 123974 30.05
 
 

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy>=100
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w2%.
  • description:A strong attack that deals $<damage> damage to all enemies in front of it, and reduces the effectiveness of any healing the victim receives by {$s2=10}% for {$d=6 seconds}. |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1603 9.2% 161.2 1.82sec 2981 2022 Direct 161.2 2533 5064 2981 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.17 161.17 0.00 0.00 1.4744 0.0000 480404.21 686795.51 30.05 2021.66 2021.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 132.68 82.32% 2533.27 2284 3056 2533.83 2482 2580 336123 480529 30.05
crit 28.49 17.68% 5064.10 4569 6113 5064.87 4775 5471 144281 206267 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - urzul 1322 / 197
Many Faced Bite 496 0.4% 10.5 12.33sec 2093 2093 Direct 10.5 1777 3550 2093 17.8%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.52 10.52 0.00 0.00 1.0000 0.0000 22015.91 31474.39 30.05 2093.16 2093.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.64 82.16% 1776.77 1519 2032 1774.19 0 2032 15355 21951 30.00
crit 1.88 17.84% 3549.87 3037 4064 2835.18 0 4064 6661 9523 24.00
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 826 0.7% 47.0 2.69sec 775 653 Direct 47.0 659 1318 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.04 47.04 0.00 0.00 1.1868 0.0000 36458.02 52121.11 30.05 653.04 653.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.76 82.39% 658.87 562 753 658.71 569 753 25537 36508 30.05
crit 8.29 17.61% 1318.18 1125 1505 1302.91 0 1505 10921 15613 29.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - void_terror 1804 / 270
Double Breath 0 (147) 0.0% (0.8%) 0.0 0.00sec 0 7303

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7302.53 7302.53
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 490 0.4% 7.8 17.68sec 2783 0 Direct 7.8 2365 4734 2783 17.7%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 21813.35 21813.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.45 82.35% 2364.67 2026 2711 2356.26 0 2711 15263 15263 0.00
crit 1.38 17.65% 4733.97 4053 5422 3342.04 0 5422 6550 6550 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 488 0.4% 7.8 17.68sec 2775 0 Direct 7.8 2365 4729 2775 17.3%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 21753.57 21753.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.48 82.65% 2365.23 2026 2711 2355.76 0 2711 15323 15323 0.00
crit 1.36 17.35% 4728.72 4053 5422 3335.71 0 5422 6430 6430 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 826 0.7% 47.3 2.76sec 776 655 Direct 47.3 659 1317 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.29 47.29 0.00 0.00 1.1850 0.0000 36684.73 52445.23 30.05 654.68 654.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.91 82.28% 659.08 562 753 658.57 569 753 25644 36661 30.05
crit 8.38 17.72% 1317.46 1125 1505 1304.24 0 1505 11041 15785 29.77
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vilefiend 3120 / 1557
Bile Spit 1093 3.1% 6.8 47.18sec 23942 0 Direct 6.8 8822 17652 10371 17.6%  
Periodic 33.3 2780 0 2780 0.0% 22.2%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 6.81 33.33 33.33 0.0000 2.0000 163256.66 163256.66 0.00 2449.21 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.61 82.45% 8821.92 8474 10104 8822.31 8646 9547 49510 49510 0.00
crit 1.19 17.55% 17652.04 16947 20207 12914.35 0 20207 21091 21091 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.3 100.00% 2780.06 2502 3310 2780.46 2622 2868 92655 92655 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 732 2.1% 30.1 9.81sec 3643 3643 Direct 30.1 3101 6202 3643 17.5%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.07 30.07 0.00 0.00 1.0000 0.0000 109555.35 156622.52 30.05 3643.46 3643.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.81 82.51% 3100.87 2737 3621 3101.63 2897 3224 76931 109982 30.05
crit 5.26 17.49% 6202.15 5474 7243 6178.41 0 7243 32625 46641 29.93
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1295 3.7% 107.8 2.71sec 1795 1340 Direct 107.8 1525 3050 1796 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.81 107.81 0.00 0.00 1.3400 0.0000 193569.99 276731.55 30.05 1339.89 1339.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.70 82.27% 1525.15 1337 1775 1525.51 1461 1570 135275 193393 30.05
crit 19.11 17.73% 3050.01 2673 3550 3050.59 2814 3304 58294 83339 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - darkhound 1295 / 195
Fel Bite 467 0.4% 10.0 13.16sec 2094 2094 Direct 10.0 1778 3559 2094 17.7%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 10.01 0.00 0.00 1.0000 0.0000 20950.48 29951.23 30.05 2093.79 2093.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.23 82.28% 1778.28 1519 2032 1772.66 0 2000 14641 20931 29.94
crit 1.77 17.72% 3558.65 3037 4064 2772.19 0 4064 6309 9020 23.41
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 828 0.7% 47.6 2.69sec 775 653 Direct 47.6 659 1318 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.55 47.55 0.00 0.00 1.1871 0.0000 36842.11 52670.22 30.05 652.65 652.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.20 82.43% 658.95 562 753 658.46 570 747 25830 36927 30.05
crit 8.35 17.57% 1318.32 1125 1505 1301.15 0 1505 11012 15743 29.67
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3371 / 2217
Dreadbite 1066 4.0% 29.0 21.07sec 7257 0 Direct 29.0 6176 12358 7257 17.5%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.95 28.95 0.00 0.00 0.0000 0.0000 210107.12 210107.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.89 82.51% 6175.86 5711 7613 6176.21 5962 6402 147521 147521 0.00
crit 5.06 17.49% 12358.04 11423 15227 12314.92 0 15227 62586 62586 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.7% 311.1 1.90sec 1461 1106 Direct 311.1 1242 2484 1461 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.12 311.12 0.00 0.00 1.3212 0.0000 454669.23 650004.26 30.05 1106.13 1106.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.18 82.34% 1242.17 1105 1473 1242.35 1226 1262 318224 454939 30.05
crit 54.93 17.66% 2483.92 2211 2947 2484.21 2370 2602 136445 195065 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3086 / 3005
Fel Firebolt 3086 17.2% 1201.5 0.24sec 750 508 Direct 1196.7 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1201.53 1196.65 0.00 0.00 1.4756 0.0000 900866.30 900866.30 0.00 508.10 508.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 985.06 82.32% 639.72 569 761 639.80 631 651 630167 630167 0.00
crit 211.59 17.68% 1279.37 1138 1523 1279.53 1247 1318 270700 270700 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1691 / 256
melee 818 0.7% 47.2 2.75sec 775 651 Direct 47.2 659 1318 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.20 47.20 0.00 0.00 1.1900 0.0000 36566.35 52275.99 30.05 651.01 651.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.90 82.41% 658.83 562 753 658.10 569 735 25626 36635 30.05
crit 8.30 17.59% 1317.55 1125 1505 1300.87 0 1505 10941 15641 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 409 0.3% 47.2 2.75sec 388 307 Direct 47.2 329 659 388 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.20 47.20 0.00 0.00 1.2605 0.0000 18291.80 26150.32 30.05 307.46 307.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.87 82.35% 329.41 281 376 329.07 285 366 12804 18305 30.05
crit 8.33 17.65% 658.85 562 753 651.20 0 753 5488 7845 29.73
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 464 0.4% 10.0 13.38sec 2092 2092 Direct 10.0 1777 3558 2092 17.7%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.97 9.97 0.00 0.00 1.0000 0.0000 20856.42 29816.76 30.05 2092.34 2092.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.20 82.30% 1777.20 1519 2032 1773.76 0 1983 14579 20843 29.99
crit 1.76 17.70% 3557.66 3037 4064 2744.35 0 4064 6277 8974 23.19
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - demonic_tyrant 4664 / 819
Demonfire 4664 4.7% 37.6 6.87sec 6511 4890 Direct 37.6 5548 11097 6524 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.57 0.00 0.00 1.3316 0.0000 245137.39 245137.39 0.00 4889.64 4889.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.96 82.41% 5548.14 5029 5917 5551.30 5447 5667 171793 171793 0.00
crit 6.61 17.59% 11097.21 10059 11834 11089.13 0 11834 73344 73344 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - illidari_satyr 1242 / 187
melee 407 0.3% 46.8 2.74sec 387 326 Direct 46.8 329 659 387 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.85 46.85 0.00 0.00 1.1894 0.0000 18143.66 25938.54 30.05 325.63 325.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.62 82.45% 329.48 281 376 329.18 285 370 12726 18193 30.05
crit 8.22 17.55% 658.74 562 753 647.35 0 753 5418 7745 29.56
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 204 0.2% 46.8 2.74sec 194 154 Direct 46.8 165 329 194 17.6%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.85 46.85 0.00 0.00 1.2591 0.0000 9072.05 12969.59 30.05 153.80 153.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.62 82.44% 164.75 141 188 164.60 142 186 6363 9096 30.05
crit 8.23 17.56% 329.31 281 376 324.49 0 376 2709 3873 29.64
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 631 0.5% 10.1 13.01sec 2796 2797 Direct 10.1 2374 4749 2796 17.8%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.11 10.11 0.00 0.00 1.0000 0.0000 28267.16 28267.16 0.00 2796.51 2796.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.31 82.21% 2373.90 2026 2711 2366.54 0 2711 19727 19727 0.00
crit 1.80 17.79% 4748.88 4053 5422 3722.04 0 5422 8540 8540 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - vicious_hellhound 1045 / 158
Demon Fangs 646 0.6% 10.4 12.91sec 2790 2791 Direct 10.4 2372 4751 2790 17.6%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 10.42 0.00 0.00 1.0000 0.0000 29064.74 29064.74 0.00 2790.66 2790.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.58 82.41% 2372.19 2026 2711 2366.71 0 2711 20363 20363 0.00
crit 1.83 17.59% 4750.79 4053 5422 3742.51 0 5422 8702 8702 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 399 0.3% 91.6 1.42sec 194 320 Direct 91.6 165 330 194 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.58 91.58 0.00 0.00 0.6067 0.0000 17797.29 25443.36 30.05 320.31 320.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.38 82.32% 165.13 141 188 164.85 142 184 12448 17796 30.05
crit 16.19 17.68% 330.32 281 376 329.23 0 376 5349 7647 30.00
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - bilescourge 3816 / 572
Toxic Bile 3816 3.2% 60.6 2.08sec 2798 2968 Direct 60.5 2379 4757 2800 17.7%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.57 60.54 0.00 0.00 0.9427 0.0000 169483.28 169483.28 0.00 2968.29 2968.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.84 82.33% 2379.48 2026 2711 2374.53 0 2646 118601 118601 0.00
crit 10.70 17.67% 4756.57 4053 5422 4714.35 0 5422 50882 50882 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - shivarra 1899 / 287
melee 817 0.7% 47.2 2.80sec 775 652 Direct 47.2 659 1319 775 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.15 47.15 0.00 0.00 1.1881 0.0000 36537.84 52235.23 30.05 652.23 652.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.85 82.40% 658.80 562 753 658.00 569 753 25598 36595 30.05
crit 8.30 17.60% 1318.60 1125 1505 1298.07 0 1505 10940 15640 29.61
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 409 0.3% 47.2 2.80sec 388 308 Direct 47.2 329 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.15 47.15 0.00 0.00 1.2582 0.0000 18290.15 26147.97 30.05 308.29 308.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.79 82.27% 329.39 281 376 329.02 285 376 12778 18267 30.05
crit 8.36 17.73% 659.35 562 753 649.07 0 753 5513 7881 29.63
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (102) 0.0% (0.6%) 0.0 0.00sec 0 3932

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3932.10 3932.10
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 168 0.1% 7.7 18.37sec 982 0 Direct 7.7 835 1671 982 17.6%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7550.16 10793.86 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.39% 834.76 717 959 831.29 0 959 5288 7560 29.94
crit 1.35 17.61% 1670.72 1434 1919 1189.82 0 1919 2262 3233 21.39
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 168 0.1% 7.7 18.37sec 982 0 Direct 7.7 835 1672 982 17.7%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7554.09 10799.48 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.33 82.34% 834.67 717 959 830.49 0 959 5284 7555 29.91
crit 1.36 17.66% 1671.60 1434 1919 1181.15 0 1919 2270 3245 21.24
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 168 0.1% 7.7 18.37sec 981 0 Direct 7.7 835 1671 981 17.5%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7545.59 10787.33 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 82.47% 834.73 717 959 830.90 0 959 5293 7567 29.93
crit 1.35 17.53% 1671.07 1434 1919 1176.54 0 1919 2253 3220 21.16
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 169 0.1% 7.7 18.37sec 986 0 Direct 7.7 835 1670 986 18.1%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 0.0000 0.0000 7580.15 10836.74 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.30 81.92% 834.81 717 959 830.93 0 959 5258 7518 29.93
crit 1.39 18.08% 1670.23 1434 1919 1202.28 0 1919 2322 3319 21.63
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - eye_of_guldan 985 / 81
Eye of Gul'dan 985 0.5% 27.7 4.68sec 868 1139 Periodic 60.2 399 0 399 0.0% 58.9%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.66 0.00 60.18 60.18 0.7617 2.9368 24004.31 24004.31 0.00 121.35 1139.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.2 100.00% 398.84 182 484 396.56 0 435 24004 24004 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4580 / 402
melee 3053 1.5% 21.5 1.61sec 3682 3101 Direct 21.5 3124 6237 3682 17.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.51 21.51 0.00 0.00 1.1871 0.0000 79188.93 113210.09 30.05 3101.43 3101.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.66 82.09% 3124.29 2665 3566 3116.82 2698 3481 55165 78865 30.05
crit 3.85 17.91% 6236.64 5330 7131 5981.43 0 7131 24024 34345 28.84
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1527 0.8% 21.5 1.61sec 1841 1465 Direct 21.5 1562 3123 1841 17.9%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.51 21.51 0.00 0.00 1.2562 0.0000 39596.27 56607.62 30.05 1465.50 1465.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.66 82.11% 1561.62 1333 1783 1558.30 1348 1746 27581 39430 30.05
crit 3.85 17.89% 3123.09 2675 3566 2983.35 0 3509 12016 17178 28.81
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_ID_Felguard
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.87sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.5 21.07sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.54 0.00 0.00 0.00 1.2055 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
Demonic Strength 5.5 60.47sec

Stats details: demonic_strength

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.2156 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demonic_strength

Static Values
  • id:267171
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
Spelldata
  • id:267171
  • name:Demonic Strength
  • school:shadow
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Felguard
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 183.55sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.0913 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.52sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 1.5060 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Felguard 1.0 0.00sec

Stats details: summon_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_felguard

Static Values
  • id:30146
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:30146
  • name:Summon Felguard
  • school:shadow
  • tooltip:
  • description:Summons a Felguard under your command as a powerful melee combatant.
 
summon_random_demon 17.9 13.74sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.18sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.82 0.00 0.00 0.00 1.5513 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 101.8sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.44% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.7 15.0 23.5sec 10.4sec 51.59% 83.02% 15.0(15.0) 0.1

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:51.59%

Trigger Attempt Success

  • trigger_pct:19.98%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 23.9 32.3 12.0sec 5.0sec 41.32% 100.00% 5.0(5.0) 0.4

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.72%
  • demonic_core_2:16.27%
  • demonic_core_3:5.67%
  • demonic_core_4:2.65%

Trigger Attempt Success

  • trigger_pct:23.79%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.58% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.5 17.6 26.8sec 10.2sec 65.77% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.42%
  • dreadstalkers_4:6.35%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.6 166.2sec 2.1sec 1.42% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.7sec 171.7sec 14.79% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.11%
  • ignition_mages_fuse_2:3.07%
  • ignition_mages_fuse_3:3.03%
  • ignition_mages_fuse_4:2.87%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 183.5sec 183.5sec 10.14% 18.33% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 2.9 66.6sec 36.7sec 44.25% 0.00% 2.9(40.3) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.31%
  • overwhelming_power_2:1.34%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.41%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.65%
  • overwhelming_power_11:1.69%
  • overwhelming_power_12:1.74%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.98%
  • overwhelming_power_18:2.04%
  • overwhelming_power_19:2.10%
  • overwhelming_power_20:2.16%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 183.5sec 13.7sec 19.48% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.61%
  • portal_summons_2:0.79%
  • portal_summons_3:1.20%
  • portal_summons_4:1.51%
  • portal_summons_5:1.89%
  • portal_summons_6:1.89%
  • portal_summons_7:3.82%
  • portal_summons_8:5.63%
  • portal_summons_9:1.14%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 151.2sec 95.7sec 1.47% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.3sec 10.4sec 67.62% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.63%
  • quick_navigation_2:17.27%
  • quick_navigation_3:16.52%
  • quick_navigation_4:16.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.3sec 52.3sec 17.43% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.7sec 16.97% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:16.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.58% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.58%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.92% 0.00% 0.0(0.0) 6.3

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.92%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 184.2 127.5sec 0.0sec 97.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.83%
  • wild_imps_2:2.08%
  • wild_imps_3:10.88%
  • wild_imps_4:20.86%
  • wild_imps_5:8.02%
  • wild_imps_6:14.90%
  • wild_imps_7:17.81%
  • wild_imps_8:5.16%
  • wild_imps_9:3.24%
  • wild_imps_10:3.30%
  • wild_imps_11:4.36%
  • wild_imps_12:1.85%
  • wild_imps_13:1.23%
  • wild_imps_14:1.25%
  • wild_imps_15:0.37%
  • wild_imps_16:0.14%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
felguard: Demonic Strength 5.5 0.0 60.4sec 60.5sec 10.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Felguard_felguard
  • cooldown name:buff_demonic_strength
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_strength_1:10.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267171
  • name:Demonic Strength
  • tooltip:Your next Felstorm will deal {$s2=400}% increased damage.
  • description:Infuse your Felguard with demonic strength and command it to charge your target and unleash a Felstorm that will deal {$s2=400}% increased damage.
  • max_stacks:0
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DStr_ID_Felguard
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.9 13.8sec
one_shard_hog 9.3 21.7sec
two_shard_hog 4.0 52.1sec
three_shard_hog 48.4 5.8sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_ID_Felguard
call_dreadstalkers Soul Shard 14.5 17.0 1.2 1.2 0.0
demonbolt Mana 47.4 94795.9 2000.0 2043.2 4.2
hand_of_guldan Soul Shard 61.7 162.5 2.6 2.6 1979.7
shadow_bolt Mana 91.2 182426.1 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7146.1 2000.0 2000.1 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - felguard
demonic_strength_felstorm Energy 5.4 325.7 60.0 60.0 731.8
felstorm Energy 10.2 610.2 60.0 60.0 180.6
legion_strike Energy 53.2 3193.5 60.0 60.0 90.8
pet - wild_imp
fel_firebolt Energy 1201.5 18247.1 15.2 15.2 49.4
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 47.40 94.66 (50.93%) 2.00 0.14 0.14%
shadow_bolt Soul Shard 91.21 91.21 (49.07%) 1.00 0.00 0.00%
mana_regen Mana 555.00 281850.99 (100.00%) 507.84 17589.44 5.87%
pet - felguard
energy_regen Energy 379.06 3989.89 (100.00%) 10.53 18.58 0.46%
pet - demonic_tyrant
energy_regen Energy 37.65 0.00 (0.00%) 0.00 759.87 100.00%
pet - bilescourge
energy_regen Energy 10.16 0.00 (0.00%) 0.00 140.10 100.00%
pet - bilescourge
energy_regen Energy 13.57 0.00 (0.00%) 0.00 187.07 100.00%
pet - bilescourge
energy_regen Energy 15.38 0.00 (0.00%) 0.00 212.99 100.00%
pet - bilescourge
energy_regen Energy 11.13 0.00 (0.00%) 0.00 153.62 100.00%
pet - bilescourge
energy_regen Energy 9.30 0.00 (0.00%) 0.00 129.29 100.00%
Resource RPS-Gain RPS-Loss
Mana 939.55 947.94
Soul Shard 0.62 0.62
Combat End Resource Mean Min Max
Mana 97461.26 93817.00 100000.00
Soul Shard 2.57 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.5%

Statistics & Data Analysis

Fight Length
Sample Data T22_Warlock_Demonology Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data T22_Warlock_Demonology Damage Per Second
Count 4999
Mean 17484.58
Minimum 16046.45
Maximum 19791.82
Spread ( max - min ) 3745.37
Range [ ( max - min ) / 2 * 100% ] 10.71%
Standard Deviation 558.5701
5th Percentile 16644.08
95th Percentile 18465.86
( 95th Percentile - 5th Percentile ) 1821.77
Mean Distribution
Standard Deviation 7.9002
95.00% Confidence Intervall ( 17469.10 - 17500.07 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3921
0.1 Scale Factor Error with Delta=300 2664
0.05 Scale Factor Error with Delta=300 10654
0.01 Scale Factor Error with Delta=300 266342
Priority Target DPS
Sample Data T22_Warlock_Demonology Priority Target Damage Per Second
Count 4999
Mean 17484.58
Minimum 16046.45
Maximum 19791.82
Spread ( max - min ) 3745.37
Range [ ( max - min ) / 2 * 100% ] 10.71%
Standard Deviation 558.5701
5th Percentile 16644.08
95th Percentile 18465.86
( 95th Percentile - 5th Percentile ) 1821.77
Mean Distribution
Standard Deviation 7.9002
95.00% Confidence Intervall ( 17469.10 - 17500.07 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3921
0.1 Scale Factor Error with Delta=300 2664
0.05 Scale Factor Error with Delta=300 10654
0.01 Scale Factor Error with Delta=300 266342
DPS(e)
Sample Data T22_Warlock_Demonology Damage Per Second (Effective)
Count 4999
Mean 17484.58
Minimum 16046.45
Maximum 19791.82
Spread ( max - min ) 3745.37
Range [ ( max - min ) / 2 * 100% ] 10.71%
Damage
Sample Data T22_Warlock_Demonology Damage
Count 4999
Mean 1246902.60
Minimum 893862.27
Maximum 1638647.73
Spread ( max - min ) 744785.46
Range [ ( max - min ) / 2 * 100% ] 29.87%
DTPS
Sample Data T22_Warlock_Demonology Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T22_Warlock_Demonology Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T22_Warlock_Demonology Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T22_Warlock_Demonology Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T22_Warlock_Demonology Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T22_Warlock_Demonology Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data T22_Warlock_DemonologyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T22_Warlock_Demonology Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.36 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
B 5.47 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
C 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
D 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
E 4.85 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
F 11.53 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
G 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
H 45.01 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
I 42.55 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
J 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
K 91.71 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
O 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
P 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Q 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
R 14.57 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
S 1.97 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
T 0.03 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
U 3.84 demonbolt,if=buff.demonic_core.up
V 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
W 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
X 1.02 call_dreadstalkers
Y 0.53 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Z 1.81 hand_of_guldan,if=soul_shard>=5
a 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467BWOPRKRS9AKRKRKRKRKRKRKKKKKFHIHKIHIIHIHIIHIHIIKHFIKEHKKKHIBIKHFKKHKKKHIKHKKKKKHIKFHIIEHG8KKHKKKKFKHIKHBIIHIHIIKHFIHIKKKEHIHIKKFHKIHKKKKKZKKKXYKKKBKWRRURUOT9AKPRURKRKKKHIIHIKKHFIHKKKHKKIHIKKHFEKKBKHKKIHIIHKFKHKKKHKKKHKIIFHIKKEHGIHIKHKKFK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_ID_Felguard 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_felguard Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 default B demonic_strength Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.278 nether_portal_building W nether_portal Fluffy_Pillow 99278.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, archive_of_the_titans, battle_potion_of_intellect
0:02.260 nether_portal_active O summon_vilefiend Fluffy_Pillow 100000.0/100000: 100% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:03.568 nether_portal_active P call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:04.875 nether_portal_active R hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:05.858 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:07.167 nether_portal_active R hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans(2), battle_potion_of_intellect
0:08.151 nether_portal_active S summon_demonic_tyrant Fluffy_Pillow 98989.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect
0:09.459 default 9 use_items Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect
0:09.459 default A berserking Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.459 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.559 nether_portal_active R hand_of_guldan Fluffy_Pillow 97104.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.385 build_a_shard K shadow_bolt Fluffy_Pillow 97930.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.486 nether_portal_active R hand_of_guldan Fluffy_Pillow 97031.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(6), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.313 build_a_shard K shadow_bolt Fluffy_Pillow 97858.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:14.414 nether_portal_active R hand_of_guldan Fluffy_Pillow 96959.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.216 build_a_shard K shadow_bolt Fluffy_Pillow 97761.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.284 nether_portal_active R hand_of_guldan Fluffy_Pillow 96829.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.083 build_a_shard K shadow_bolt Fluffy_Pillow 97628.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:18.014 nether_portal_active R hand_of_guldan Fluffy_Pillow 96559.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), overwhelming_power(24), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.769 build_a_shard K shadow_bolt Fluffy_Pillow 97314.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), overwhelming_power(25), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.675 nether_portal_active R hand_of_guldan Fluffy_Pillow 96220.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation, overwhelming_power(24), archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.457 build_a_shard K shadow_bolt Fluffy_Pillow 97002.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation, overwhelming_power(23), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(3)
0:21.501 build_a_shard K shadow_bolt Fluffy_Pillow 96046.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation, overwhelming_power(22), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.524 build_a_shard K shadow_bolt Fluffy_Pillow 95069.0/100000: 95% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation, overwhelming_power(21), archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.553 build_a_shard K shadow_bolt Fluffy_Pillow 94098.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(8), quick_navigation, overwhelming_power(20), archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.586 build_a_shard K shadow_bolt Fluffy_Pillow 93131.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation, overwhelming_power(19), archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.622 default F call_dreadstalkers Fluffy_Pillow 92167.0/100000: 92% mana | 5.0/5: 100% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.381 default H hand_of_guldan Fluffy_Pillow 92926.0/100000: 93% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.145 default I demonbolt Fluffy_Pillow 93690.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(6), ignition_mages_fuse(5)
0:27.911 default H hand_of_guldan Fluffy_Pillow 92456.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(16), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.677 build_a_shard K shadow_bolt Fluffy_Pillow 93222.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(8), dreadstalkers(4), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(6), ignition_mages_fuse(5)
0:29.702 default I demonbolt Fluffy_Pillow 92247.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(4), supreme_commander, wild_imps(3), dreadstalkers(4), vilefiend, eyes_of_guldan(4), portal_summons(8), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(6)
0:30.591 default H hand_of_guldan Fluffy_Pillow 91136.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, eyes_of_guldan(4), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(7)
0:31.484 default I demonbolt Fluffy_Pillow 92029.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(6), dreadstalkers(4), vilefiend, eyes_of_guldan(4), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(7)
0:32.383 default I demonbolt Fluffy_Pillow 90928.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(4), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, eyes_of_guldan(4), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(7)
0:33.288 default H hand_of_guldan Fluffy_Pillow 89833.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(8), dreadstalkers(2), vilefiend, eyes_of_guldan(4), quick_navigation(3), overwhelming_power(10), archive_of_the_titans(7)
0:34.198 default I demonbolt Fluffy_Pillow 90743.0/100000: 91% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(8), dreadstalkers(2), eyes_of_guldan(4), quick_navigation(3), overwhelming_power(9), archive_of_the_titans(7)
0:35.113 default H hand_of_guldan Fluffy_Pillow 89658.0/100000: 90% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(6), dreadstalkers(2), eyes_of_guldan(4), quick_navigation(3), overwhelming_power(8), archive_of_the_titans(8)
0:36.033 default I demonbolt Fluffy_Pillow 90578.0/100000: 91% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(8), dreadstalkers(2), eyes_of_guldan(4), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(8)
0:36.959 default I demonbolt Fluffy_Pillow 89504.0/100000: 90% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), eyes_of_guldan(4), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(8)
0:37.884 default H hand_of_guldan Fluffy_Pillow 88429.0/100000: 88% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(9), eyes_of_guldan(4), quick_navigation(3), overwhelming_power(6), archive_of_the_titans(8)
0:38.815 default I demonbolt Fluffy_Pillow 89360.0/100000: 89% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(9), quick_navigation(3), overwhelming_power(5), archive_of_the_titans(8)
0:39.750 default H hand_of_guldan Fluffy_Pillow 88295.0/100000: 88% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(2), wild_imps(7), quick_navigation(3), overwhelming_power(4), archive_of_the_titans(8)
0:40.690 default I demonbolt Fluffy_Pillow 89235.0/100000: 89% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(2), wild_imps(9), quick_navigation(3), overwhelming_power(3), archive_of_the_titans(9)
0:41.636 default I demonbolt Fluffy_Pillow 88181.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(9), quick_navigation(3), overwhelming_power(2), archive_of_the_titans(9)
0:42.873 build_a_shard K shadow_bolt Fluffy_Pillow 87418.0/100000: 87% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(9), quick_navigation(3), overwhelming_power, archive_of_the_titans(9)
0:44.533 default H hand_of_guldan Fluffy_Pillow 87078.0/100000: 87% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(8), quick_navigation(3), archive_of_the_titans(9)
0:45.785 default F call_dreadstalkers Fluffy_Pillow 88330.0/100000: 88% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(3), archive_of_the_titans(10)
0:47.038 default I demonbolt Fluffy_Pillow 89583.0/100000: 90% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:48.290 build_a_shard K shadow_bolt Fluffy_Pillow 88835.0/100000: 89% mana | 3.0/5: 60% soul_shard wild_imps(8), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(10)
0:49.959 default E summon_vilefiend Fluffy_Pillow 88504.0/100000: 89% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(10)
0:51.620 default H hand_of_guldan Fluffy_Pillow 90165.0/100000: 90% mana | 3.0/5: 60% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:52.865 build_a_shard K shadow_bolt Fluffy_Pillow 91410.0/100000: 91% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:54.524 build_a_shard K shadow_bolt Fluffy_Pillow 91069.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(11)
0:56.182 build_a_shard K shadow_bolt Fluffy_Pillow 90727.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:57.841 default H hand_of_guldan Fluffy_Pillow 90386.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(12)
0:59.088 default I demonbolt Fluffy_Pillow 91633.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(3), vilefiend, quick_navigation(4), archive_of_the_titans(12)
1:00.334 default B demonic_strength Fluffy_Pillow 90879.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:01.579 default I demonbolt Fluffy_Pillow 92124.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(13)
1:02.825 build_a_shard K shadow_bolt Fluffy_Pillow 91370.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:04.408 default H hand_of_guldan Fluffy_Pillow 90953.0/100000: 91% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(13)
1:05.595 default F call_dreadstalkers Fluffy_Pillow 92140.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(14)
1:06.974 build_a_shard K shadow_bolt Fluffy_Pillow 93519.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(14)
1:08.556 build_a_shard K shadow_bolt Fluffy_Pillow 93101.0/100000: 93% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(25), archive_of_the_titans(14)
1:09.940 default H hand_of_guldan Fluffy_Pillow 92485.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(24), archive_of_the_titans(14)
1:10.981 build_a_shard K shadow_bolt Fluffy_Pillow 93526.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(15)
1:12.377 build_a_shard K shadow_bolt Fluffy_Pillow 92922.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), overwhelming_power(21), archive_of_the_titans(15)
1:13.880 build_a_shard K shadow_bolt Fluffy_Pillow 92425.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), overwhelming_power(20), archive_of_the_titans(15)
1:15.392 default H hand_of_guldan Fluffy_Pillow 91937.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), overwhelming_power(25), archive_of_the_titans(16)
1:16.498 default I demonbolt Fluffy_Pillow 93043.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), dreadstalkers(2), overwhelming_power(24), archive_of_the_titans(16)
1:17.608 build_a_shard K shadow_bolt Fluffy_Pillow 92153.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), overwhelming_power(23), archive_of_the_titans(16)
1:19.093 default H hand_of_guldan Fluffy_Pillow 91638.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), overwhelming_power(21), archive_of_the_titans(16)
1:20.221 build_a_shard K shadow_bolt Fluffy_Pillow 92766.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(4), overwhelming_power(20), archive_of_the_titans(17)
1:21.733 build_a_shard K shadow_bolt Fluffy_Pillow 92278.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), overwhelming_power(19), archive_of_the_titans(17)
1:23.256 build_a_shard K shadow_bolt Fluffy_Pillow 91801.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, overwhelming_power(17), archive_of_the_titans(17)
1:24.783 build_a_shard K shadow_bolt Fluffy_Pillow 91328.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(7), quick_navigation, overwhelming_power(16), archive_of_the_titans(17)
1:26.321 build_a_shard K shadow_bolt Fluffy_Pillow 90866.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(14), archive_of_the_titans(18)
1:27.877 default H hand_of_guldan Fluffy_Pillow 90422.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(13), archive_of_the_titans(18)
1:29.050 default I demonbolt Fluffy_Pillow 91595.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(11), archive_of_the_titans(18)
1:30.238 build_a_shard K shadow_bolt Fluffy_Pillow 90783.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(2), quick_navigation, overwhelming_power(10), archive_of_the_titans(19)
1:31.831 default F call_dreadstalkers Fluffy_Pillow 90376.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(9), archive_of_the_titans(19)
1:33.032 default H hand_of_guldan Fluffy_Pillow 91577.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(7), archive_of_the_titans(19)
1:34.249 default I demonbolt Fluffy_Pillow 92794.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(2), overwhelming_power(6), archive_of_the_titans(19)
1:35.465 default I demonbolt Fluffy_Pillow 92010.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(5), archive_of_the_titans(20)
1:36.688 default E summon_vilefiend Fluffy_Pillow 91233.0/100000: 91% mana | 5.0/5: 100% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20)
1:38.328 default H hand_of_guldan Fluffy_Pillow 92873.0/100000: 93% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), overwhelming_power(2), archive_of_the_titans(20)
1:39.572 default G summon_demonic_tyrant Fluffy_Pillow 94117.0/100000: 94% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power, archive_of_the_titans(20)
1:41.233 default 8 potion Fluffy_Pillow 93778.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)
1:41.233 build_a_shard K shadow_bolt Fluffy_Pillow 93778.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
1:42.903 build_a_shard K shadow_bolt Fluffy_Pillow 93448.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:44.560 default H hand_of_guldan Fluffy_Pillow 93105.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:45.806 build_a_shard K shadow_bolt Fluffy_Pillow 94351.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:47.467 build_a_shard K shadow_bolt Fluffy_Pillow 94012.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
1:49.126 build_a_shard K shadow_bolt Fluffy_Pillow 93671.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:50.708 build_a_shard K shadow_bolt Fluffy_Pillow 93253.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:52.291 default F call_dreadstalkers Fluffy_Pillow 92836.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:53.874 build_a_shard K shadow_bolt Fluffy_Pillow 94419.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:55.455 default H hand_of_guldan Fluffy_Pillow 94000.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(11), dreadstalkers(4), vilefiend, tyrant, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:56.641 default I demonbolt Fluffy_Pillow 95186.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:57.828 build_a_shard K shadow_bolt Fluffy_Pillow 94373.0/100000: 94% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(12), dreadstalkers(4), vilefiend, quick_navigation_final, archive_of_the_titans(20), battle_potion_of_intellect
1:59.410 default H hand_of_guldan Fluffy_Pillow 93955.0/100000: 94% mana | 3.0/5: 60% soul_shard demonic_core(2), supreme_commander, wild_imps(10), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:00.687 default B demonic_strength Fluffy_Pillow 95232.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:01.962 default I demonbolt Fluffy_Pillow 96507.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(2), supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:03.239 default I demonbolt Fluffy_Pillow 95784.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, supreme_commander, wild_imps(12), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:04.516 default H hand_of_guldan Fluffy_Pillow 95061.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:05.793 default I demonbolt Fluffy_Pillow 96338.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core(2), supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, archive_of_the_titans(20), battle_potion_of_intellect
2:07.070 default H hand_of_guldan Fluffy_Pillow 95615.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(3), supreme_commander, wild_imps(5), vilefiend, archive_of_the_titans(20)
2:08.347 default I demonbolt Fluffy_Pillow 96892.0/100000: 97% mana | 0.0/5: 0% soul_shard demonic_core(3), supreme_commander, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:09.616 default I demonbolt Fluffy_Pillow 96161.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:10.884 build_a_shard K shadow_bolt Fluffy_Pillow 95429.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:12.573 default H hand_of_guldan Fluffy_Pillow 95118.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:13.841 default F call_dreadstalkers Fluffy_Pillow 96386.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
2:15.137 default I demonbolt Fluffy_Pillow 97682.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(8), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:16.406 default H hand_of_guldan Fluffy_Pillow 96951.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:17.676 default I demonbolt Fluffy_Pillow 98221.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:18.944 build_a_shard K shadow_bolt Fluffy_Pillow 97489.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:20.634 build_a_shard K shadow_bolt Fluffy_Pillow 97179.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:22.316 build_a_shard K shadow_bolt Fluffy_Pillow 96861.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:23.995 default E summon_vilefiend Fluffy_Pillow 96540.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:25.665 default H hand_of_guldan Fluffy_Pillow 98210.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:26.917 default I demonbolt Fluffy_Pillow 99462.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:28.169 default H hand_of_guldan Fluffy_Pillow 98714.0/100000: 99% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:29.420 default I demonbolt Fluffy_Pillow 99965.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:30.673 build_a_shard K shadow_bolt Fluffy_Pillow 99218.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:32.342 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:34.014 default F call_dreadstalkers Fluffy_Pillow 97676.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(6), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:35.266 default H hand_of_guldan Fluffy_Pillow 98928.0/100000: 99% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:36.520 build_a_shard K shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:38.191 default I demonbolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:39.443 default H hand_of_guldan Fluffy_Pillow 97258.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20)
2:40.697 build_a_shard K shadow_bolt Fluffy_Pillow 98512.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:42.357 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:44.017 build_a_shard K shadow_bolt Fluffy_Pillow 97665.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:45.676 build_a_shard K shadow_bolt Fluffy_Pillow 97324.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:47.334 build_a_shard K shadow_bolt Fluffy_Pillow 96982.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:48.994 nether_portal_building Z hand_of_guldan Fluffy_Pillow 96642.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
2:50.075 build_a_shard K shadow_bolt Fluffy_Pillow 97723.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
2:51.530 build_a_shard K shadow_bolt Fluffy_Pillow 97178.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
2:52.995 build_a_shard K shadow_bolt Fluffy_Pillow 96643.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
2:54.466 nether_portal_building X call_dreadstalkers Fluffy_Pillow 96114.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20)
2:55.582 nether_portal_building Y hand_of_guldan Fluffy_Pillow 97230.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20)
2:56.704 build_a_shard K shadow_bolt Fluffy_Pillow 98352.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(20)
2:58.206 build_a_shard K shadow_bolt Fluffy_Pillow 97854.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(15), archive_of_the_titans(20)
2:59.727 build_a_shard K shadow_bolt Fluffy_Pillow 97375.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), dreadstalkers(2), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
3:01.191 default B demonic_strength Fluffy_Pillow 96839.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20)
3:02.301 build_a_shard K shadow_bolt Fluffy_Pillow 97949.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20)
3:03.789 nether_portal_building W nether_portal Fluffy_Pillow 97437.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20)
3:04.910 nether_portal_active R hand_of_guldan Fluffy_Pillow 98558.0/100000: 99% mana | 5.0/5: 100% soul_shard demonic_core(2), nether_portal, wild_imps(4), dreadstalkers(2), portal_summons, quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20)
3:06.038 nether_portal_active R hand_of_guldan Fluffy_Pillow 99686.0/100000: 100% mana | 2.0/5: 40% soul_shard nether_portal, wild_imps(2), dreadstalkers(2), portal_summons(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(20)
3:07.179 nether_portal_active U demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), nether_portal, wild_imps(2), eyes_of_guldan(4), portal_summons(3), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
3:08.328 nether_portal_active R hand_of_guldan Fluffy_Pillow 99149.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(4), eyes_of_guldan(4), portal_summons(3), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
3:09.482 nether_portal_active U demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), eyes_of_guldan(4), portal_summons(4), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
3:10.644 nether_portal_active O summon_vilefiend Fluffy_Pillow 99162.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, nether_portal, wild_imps(6), eyes_of_guldan(4), portal_summons(4), overwhelming_power(3), archive_of_the_titans(20)
3:12.330 nether_portal_active T summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_calling, nether_portal, wild_imps(8), vilefiend, eyes_of_guldan(4), portal_summons(5), overwhelming_power, archive_of_the_titans(20)
3:14.020 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, nether_portal, wild_imps(8), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(20)
3:14.020 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, nether_portal, wild_imps(8), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(20), ignition_mages_fuse
3:14.020 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(8), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(20), ignition_mages_fuse
3:15.450 nether_portal_active P call_dreadstalkers Fluffy_Pillow 97435.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(5), archive_of_the_titans(20), ignition_mages_fuse
3:16.525 nether_portal_active R hand_of_guldan Fluffy_Pillow 98510.0/100000: 99% mana | 1.0/5: 20% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(6), archive_of_the_titans(20), ignition_mages_fuse
3:17.599 nether_portal_active U demonbolt Fluffy_Pillow 99584.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), archive_of_the_titans(20), ignition_mages_fuse
3:18.674 nether_portal_active R hand_of_guldan Fluffy_Pillow 98659.0/100000: 99% mana | 2.0/5: 40% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.714 build_a_shard K shadow_bolt Fluffy_Pillow 99699.0/100000: 100% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.099 nether_portal_active R hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), archive_of_the_titans(20), ignition_mages_fuse(2)
3:22.138 build_a_shard K shadow_bolt Fluffy_Pillow 99044.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.470 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:24.804 build_a_shard K shadow_bolt Fluffy_Pillow 97337.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.338 default H hand_of_guldan Fluffy_Pillow 96871.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.455 default I demonbolt Fluffy_Pillow 97988.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(11), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.573 default I demonbolt Fluffy_Pillow 97106.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(11), vilefiend, tyrant, eyes_of_guldan(4), portal_summons(7), quick_navigation, archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.689 default H hand_of_guldan Fluffy_Pillow 96222.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), vilefiend, eyes_of_guldan(4), portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(4)
3:30.800 default I demonbolt Fluffy_Pillow 97333.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(13), vilefiend, eyes_of_guldan(4), portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.879 build_a_shard K shadow_bolt Fluffy_Pillow 96412.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(11), vilefiend, eyes_of_guldan(4), portal_summons(7), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.315 build_a_shard K shadow_bolt Fluffy_Pillow 95848.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(13), vilefiend, eyes_of_guldan(4), quick_navigation(2), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.753 default H hand_of_guldan Fluffy_Pillow 95286.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(11), vilefiend, eyes_of_guldan(4), quick_navigation(2), archive_of_the_titans(20)
3:36.014 default F call_dreadstalkers Fluffy_Pillow 96547.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), vilefiend, eyes_of_guldan(4), quick_navigation(2), archive_of_the_titans(20)
3:37.276 default I demonbolt Fluffy_Pillow 97809.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:38.537 default H hand_of_guldan Fluffy_Pillow 97070.0/100000: 97% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:39.797 build_a_shard K shadow_bolt Fluffy_Pillow 98330.0/100000: 98% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:41.475 build_a_shard K shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20)
3:43.155 build_a_shard K shadow_bolt Fluffy_Pillow 97683.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:44.823 default H hand_of_guldan Fluffy_Pillow 97351.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:46.076 build_a_shard K shadow_bolt Fluffy_Pillow 98604.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
3:47.746 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:49.407 default I demonbolt Fluffy_Pillow 97666.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
3:50.488 default H hand_of_guldan Fluffy_Pillow 96747.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
3:51.575 default I demonbolt Fluffy_Pillow 97834.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(23), archive_of_the_titans(20)
3:52.624 build_a_shard K shadow_bolt Fluffy_Pillow 96883.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), quick_navigation_final, overwhelming_power(22), archive_of_the_titans(20)
3:54.027 build_a_shard K shadow_bolt Fluffy_Pillow 96286.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(20), archive_of_the_titans(20)
3:55.445 default H hand_of_guldan Fluffy_Pillow 95704.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(19), archive_of_the_titans(20)
3:56.515 default F call_dreadstalkers Fluffy_Pillow 96774.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(18), archive_of_the_titans(20)
3:57.591 default E summon_vilefiend Fluffy_Pillow 97850.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20)
3:59.031 build_a_shard K shadow_bolt Fluffy_Pillow 99290.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20)
4:00.487 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20)
4:01.950 default B demonic_strength Fluffy_Pillow 97468.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(13), archive_of_the_titans(20)
4:03.130 build_a_shard K shadow_bolt Fluffy_Pillow 98648.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(11), archive_of_the_titans(20)
4:04.722 default H hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, overwhelming_power(10), archive_of_the_titans(20)
4:05.925 build_a_shard K shadow_bolt Fluffy_Pillow 99208.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(2), dreadstalkers(2), vilefiend, overwhelming_power(9), archive_of_the_titans(20)
4:07.536 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, overwhelming_power(7), archive_of_the_titans(20)
4:09.165 default I demonbolt Fluffy_Pillow 97634.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(3), demonic_calling, wild_imps(3), vilefiend, overwhelming_power(5), archive_of_the_titans(20)
4:10.402 default H hand_of_guldan Fluffy_Pillow 96871.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, overwhelming_power(4), archive_of_the_titans(20)
4:11.647 default I demonbolt Fluffy_Pillow 98116.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(3), vilefiend, quick_navigation, overwhelming_power(3), archive_of_the_titans(20)
4:12.892 default I demonbolt Fluffy_Pillow 97361.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation, overwhelming_power(2), archive_of_the_titans(20)
4:14.143 default H hand_of_guldan Fluffy_Pillow 96612.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation, archive_of_the_titans(20)
4:15.413 build_a_shard K shadow_bolt Fluffy_Pillow 97882.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:17.102 default F call_dreadstalkers Fluffy_Pillow 97571.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:18.369 build_a_shard K shadow_bolt Fluffy_Pillow 98838.0/100000: 99% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:20.057 default H hand_of_guldan Fluffy_Pillow 98003.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:21.325 build_a_shard K shadow_bolt Fluffy_Pillow 99271.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:23.015 build_a_shard K shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:24.704 build_a_shard K shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:26.393 default H hand_of_guldan Fluffy_Pillow 97383.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:27.662 build_a_shard K shadow_bolt Fluffy_Pillow 98652.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
4:29.351 build_a_shard K shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:31.040 build_a_shard K shadow_bolt Fluffy_Pillow 97693.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation, archive_of_the_titans(20)
4:32.727 default H hand_of_guldan Fluffy_Pillow 97380.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:33.989 build_a_shard K shadow_bolt Fluffy_Pillow 98642.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
4:35.669 default I demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(5), quick_navigation(2), overwhelming_power(25), archive_of_the_titans(20)
4:36.762 default I demonbolt Fluffy_Pillow 97098.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, wild_imps(7), quick_navigation(2), overwhelming_power(24), archive_of_the_titans(20)
4:37.860 default F call_dreadstalkers Fluffy_Pillow 96196.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
4:38.966 default H hand_of_guldan Fluffy_Pillow 97302.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(22), archive_of_the_titans(20)
4:40.076 default I demonbolt Fluffy_Pillow 98412.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
4:41.200 build_a_shard K shadow_bolt Fluffy_Pillow 97536.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(19), archive_of_the_titans(20)
4:42.704 build_a_shard K shadow_bolt Fluffy_Pillow 97040.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(3), overwhelming_power(18), archive_of_the_titans(20)
4:44.208 default E summon_vilefiend Fluffy_Pillow 96544.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
4:45.729 default H hand_of_guldan Fluffy_Pillow 98065.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(15), archive_of_the_titans(20)
4:46.876 default G summon_demonic_tyrant Fluffy_Pillow 99212.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
4:48.413 default I demonbolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(12), archive_of_the_titans(20)
4:49.580 default H hand_of_guldan Fluffy_Pillow 97171.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
4:50.754 default I demonbolt Fluffy_Pillow 98345.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(10), archive_of_the_titans(20)
4:51.935 build_a_shard K shadow_bolt Fluffy_Pillow 97526.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(9), archive_of_the_titans(20)
4:53.518 default H hand_of_guldan Fluffy_Pillow 97109.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
4:54.720 build_a_shard K shadow_bolt Fluffy_Pillow 98311.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(6), archive_of_the_titans(20)
4:56.332 build_a_shard K shadow_bolt Fluffy_Pillow 97923.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(4), archive_of_the_titans(20)
4:57.959 default F call_dreadstalkers Fluffy_Pillow 97550.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation(3), overwhelming_power(3), archive_of_the_titans(20)
4:59.189 build_a_shard K shadow_bolt Fluffy_Pillow 98780.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(10), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), overwhelming_power, archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_ID_Felguard"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=felguard

DStr_ID_Imp : 17028 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17027.9 17027.9 15.4 / 0.090% 2182.9 / 12.8% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
970.9 961.3 Mana 0.00% 47.4 100.0% 100%
Talents
  • 15: Demonic Strength (Demonology Warlock)
  • 30: Demonic Calling (Demonology Warlock)
  • 60: Summon Vilefiend (Demonology Warlock)
  • 90: Inner Demons (Demonology Warlock)
  • 100: Nether Portal (Demonology Warlock)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
DStr_ID_Imp 17028
Demonbolt 1335 7.9% 47.0 5.80sec 8516 7493 Direct 47.9 7114 14231 8371 17.7%  

Stats details: demonbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.04 47.85 0.00 0.00 1.1366 0.0000 400571.81 400571.81 0.00 7492.65 7492.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.40 82.34% 7114.07 6520 8308 7115.44 6903 7306 280303 280303 0.00
crit 8.45 17.66% 14230.75 13040 16616 14233.07 13088 16616 120269 120269 0.00
 
 

Action details: demonbolt

Static Values
  • id:264178
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:264178
  • name:Demonbolt
  • school:shadowflame
  • tooltip:
  • description:Send the fiery soul of a fallen demon at the enemy, causing {$s1=0} Shadowflame damage.$?c2[ |cFFFFFFFFGenerates 2 Soul Shards.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.667000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Hand of Gul'dan 1098 6.5% 62.9 4.72sec 5235 4742 Direct 62.8 4465 8915 5246 17.5%  

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.89 62.76 0.00 0.00 1.1039 0.0000 329217.42 329217.42 0.00 4742.33 4742.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.74 82.45% 4464.84 1634 5979 4458.88 4005 4855 231030 231030 0.00
crit 11.01 17.55% 8914.58 3267 11958 8911.58 5037 11042 98188 98188 0.00
 
 

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadowflame
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.7000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:2.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadowflame
  • tooltip:
  • description:Calls down a demonic meteor full of Wild Imps which burst forth to attack the target. Deals up to ${$m1*$86040m1} Shadowflame damage on impact to all enemies within $86040A1 yds of the target{$?s196283=false}[, applies Doom to each target,][] and summons up to ${$m1*{$104317m2=0}} Wild Imps, based on Soul Shards consumed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.160000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Heed My Call 141 (201) 0.8% (1.2%) 7.3 36.78sec 8284 0 Direct 7.3 4925 9849 5799 17.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.27 7.27 0.00 0.00 0.0000 0.0000 42182.89 42182.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 82.24% 4924.62 4925 4925 4922.65 0 4925 29457 29457 0.00
crit 1.29 17.76% 9849.24 9849 9849 7226.85 0 9849 12726 12726 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4620.00
  • base_dd_max:4620.00
 
    Heed My Call (_aoe) 60 0.4% 7.3 36.78sec 2484 0 Direct 7.3 2111 4221 2485 17.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.27 7.27 0.00 0.00 0.0000 0.0000 18071.20 18071.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.98 82.28% 2110.55 2111 2111 2109.71 0 2111 12632 12632 0.00
crit 1.29 17.72% 4221.10 4221 4221 3103.98 0 4221 5440 5440 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1980.00
  • base_dd_max:1980.00
 
Shadow Bolt 1317 7.7% 94.0 3.14sec 4200 2815 Direct 93.3 3593 7186 4230 17.7%  

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.01 93.34 0.00 0.00 1.4920 0.0000 394809.77 394809.77 0.00 2814.76 2814.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.80 82.28% 3593.09 3335 4297 3593.67 3546 3652 275961 275961 0.00
crit 16.54 17.72% 7185.72 6670 8595 7186.11 6953 7603 118849 118849 0.00
 
 

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:
  • description:Sends a shadowy bolt at the enemy, causing {$s1=0} Shadow damage.$?c2[ |cFFFFFFFFGenerates 1 Soul Shard.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.345000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Volatile Blood Explosion 289 1.7% 7.3 36.98sec 11860 0 Direct 7.2 10240 20481 12023 17.4%  

Stats details: volatile_blood_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 7.20 0.00 0.00 0.0000 0.0000 86514.21 86514.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.94 82.59% 10240.44 10240 10240 10238.39 0 10240 60851 60851 0.00
crit 1.25 17.41% 20480.88 20481 20481 14728.70 0 20481 25664 25664 0.00
 
 

Action details: volatile_blood_explosion

Static Values
  • id:278057
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:10.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:278057
  • name:Volatile Blood Explosion
  • school:shadow
  • tooltip:
  • description:Your damaging spells have a chance to launch an orb of charged blood at your target, dealing {$s1=4788} Shadow damage split among all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9607.38
  • base_dd_max:9607.38
 
pet - imp 3139 / 3139
Firebolt 3139 18.4% 103.8 2.89sec 9058 6927 Direct 103.0 7760 15515 9131 17.7%  

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.82 103.00 0.00 0.00 1.3078 0.0000 940426.95 940426.95 0.00 6926.72 6926.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.79 82.32% 7759.55 7027 9401 7760.63 7638 7906 657924 657924 0.00
crit 18.21 17.68% 15515.37 14053 18802 15518.85 14554 17033 282503 282503 0.00
 
 

Action details: firebolt

Static Values
  • id:3110
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3110
  • name:Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target. |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.568000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - wrathguard 1684 / 254
melee 815 0.7% 46.9 2.77sec 777 651 Direct 46.9 660 1320 777 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.88 46.88 0.00 0.00 1.1942 0.0000 36415.40 52060.18 30.05 650.53 650.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.54 82.23% 659.56 562 753 658.61 565 738 25422 36344 30.05
crit 8.33 17.77% 1319.54 1125 1505 1299.88 0 1505 10994 15717 29.63
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 407 0.4% 46.9 2.77sec 389 307 Direct 46.9 330 659 389 17.8%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.88 46.88 0.00 0.00 1.2639 0.0000 18215.34 26041.02 30.05 307.46 307.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.52 82.17% 329.81 281 376 329.36 284 372 12703 18161 30.05
crit 8.36 17.83% 659.46 562 753 649.69 0 753 5512 7880 29.65
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Overhead Assault 463 0.4% 9.9 13.41sec 2100 2100 Direct 9.9 1779 3560 2100 18.0%  

Stats details: overhead_assault

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.91 9.91 0.00 0.00 1.0000 0.0000 20810.29 29750.80 30.05 2099.72 2099.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.13 82.01% 1779.18 1519 2032 1775.40 0 2000 14461 20674 30.00
crit 1.78 17.99% 3560.29 3037 4064 2824.37 0 4064 6349 9077 23.84
 
 

Action details: overhead_assault

Static Values
  • id:272432
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272432
  • name:Overhead Assault
  • school:physical
  • tooltip:
  • description:The Wrathguard smashes its target with a heavy overhand swing.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - bilescourge 3806 / 571
Toxic Bile 3806 3.3% 60.4 2.11sec 2803 2971 Direct 60.4 2384 4767 2805 17.6%  

Stats details: toxic_bile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.42 60.40 0.00 0.00 0.9435 0.0000 169389.22 169389.22 0.00 2971.17 2971.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.74 82.36% 2384.24 2026 2711 2379.70 0 2659 118592 118592 0.00
crit 10.66 17.64% 4767.24 4053 5422 4725.35 0 5422 50797 50797 0.00
 
 

Action details: toxic_bile

Static Values
  • id:272167
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272167
  • name:Toxic Bile
  • school:nature
  • tooltip:
  • description:The Bilescourge spits wads of Toxic Bile at its target, dealing Nature damage.
 
pet - vilefiend 3124 / 1560
Bile Spit 1096 3.2% 6.8 47.17sec 23937 0 Direct 6.8 8825 17647 10378 17.6%  
Periodic 33.5 2777 0 2777 0.0% 22.3%

Stats details: bile_spit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 6.83 33.45 33.45 0.0000 2.0000 163773.49 163773.49 0.00 2448.03 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.63 82.39% 8824.84 8474 10104 8824.83 8505 10104 49648 49648 0.00
crit 1.20 17.61% 17646.88 16947 20207 12947.12 0 20207 21219 21219 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.5 100.00% 2777.44 2502 3310 2777.69 2622 2868 92906 92906 0.00
 
 

Action details: bile_spit

Static Values
  • id:267997
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:65.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267997
  • name:Bile Spit
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:The Vilefiend spits a ball of bile at its target, dealing ${$m1*$<demoMastery>} Nature damage and an additional ${$m2*$<demoMastery>} Nature damage every $t2 sec for {$d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.680000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.200000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Headbutt 734 2.2% 30.1 9.81sec 3652 3652 Direct 30.1 3099 6205 3652 17.8%  

Stats details: headbutt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.08 30.08 0.00 0.00 1.0000 0.0000 109869.91 157072.23 30.05 3652.23 3652.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.73 82.20% 3099.38 2737 3621 3100.15 2933 3250 76648 109578 30.05
crit 5.35 17.80% 6205.33 5474 7243 6184.72 0 7243 33221 47494 29.95
 
 

Action details: headbutt

Static Values
  • id:267999
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:5.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:267999
  • name:Headbutt
  • school:physical
  • tooltip:
  • description:The Vilefiend rams its bladed head into the target, dealing {$s1=0} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 1295 3.8% 107.8 2.71sec 1796 1340 Direct 107.8 1526 3052 1796 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.84 107.84 0.00 0.00 1.3407 0.0000 193676.16 276883.32 30.05 1339.59 1339.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.74 82.29% 1525.53 1337 1775 1525.87 1459 1569 135376 193536 30.05
crit 19.10 17.71% 3052.32 2673 3550 3052.81 2808 3363 58300 83347 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - urzul 1317 / 201
Many Faced Bite 495 0.4% 10.8 12.60sec 2089 2090 Direct 10.8 1779 3552 2090 17.5%  

Stats details: many_faced_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.76 10.76 0.00 0.00 1.0000 0.0000 22475.07 32130.82 30.05 2089.54 2089.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.87 82.47% 1778.54 1519 2032 1776.34 0 1983 15777 22555 30.02
crit 1.89 17.53% 3552.18 3037 4064 2830.60 0 4064 6698 9576 23.97
 
 

Action details: many_faced_bite

Static Values
  • id:272439
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272439
  • name:Many Faced Bite
  • school:physical
  • tooltip:
  • description:The Ur'zul rears up and bites its target, dealing Physical damage. You're not sure which face actually bit you after thinking about it.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 822 0.7% 47.8 2.77sec 777 651 Direct 47.8 660 1319 777 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.81 47.81 0.00 0.00 1.1926 0.0000 37143.26 53100.75 30.05 651.45 651.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.32 82.25% 659.94 562 753 659.29 569 735 25952 37101 30.05
crit 8.48 17.75% 1319.05 1125 1505 1301.60 0 1505 11191 15999 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - dreadstalker 3373 / 2224
Dreadbite 1069 4.1% 29.0 21.04sec 7271 0 Direct 29.0 6176 12347 7271 17.7%  

Stats details: dreadbite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.04 29.04 0.00 0.00 0.0000 0.0000 211131.10 211131.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.89 82.27% 6176.29 5711 7613 6176.58 5946 6371 147549 147549 0.00
crit 5.15 17.73% 12347.15 11423 15227 12286.79 0 15227 63582 63582 0.00
 
 

Action details: dreadbite

Static Values
  • id:205196
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205196
  • name:Dreadbite
  • school:shadow
  • tooltip:
  • description:Bite the target, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 2305 8.9% 311.7 1.90sec 1462 1106 Direct 311.7 1243 2485 1462 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.69 311.69 0.00 0.00 1.3219 0.0000 455791.67 651608.93 30.05 1106.21 1106.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.57 82.32% 1242.58 1105 1473 1242.76 1227 1262 318810 455777 30.05
crit 55.12 17.68% 2485.24 2211 2947 2485.52 2374 2598 136982 195832 30.05
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.83
 
pet - wild_imp 3114 / 3045
Fel Firebolt 3114 17.9% 1217.9 0.24sec 750 508 Direct 1212.9 640 1279 753 17.7%  

Stats details: fel_firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1217.87 1212.94 0.00 0.00 1.4771 0.0000 912953.49 912953.49 0.00 507.52 507.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 998.74 82.34% 639.71 569 761 639.80 631 652 638906 638906 0.00
crit 214.20 17.66% 1279.39 1138 1523 1279.55 1245 1316 274048 274048 0.00
 
 

Action details: fel_firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Fel Firebolt
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to a target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.046000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - demonic_tyrant 4668 / 821
Demonfire 4668 4.8% 37.7 6.88sec 6525 4893 Direct 37.6 5561 11123 6538 17.6%  

Stats details: demonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.60 0.00 0.00 1.3335 0.0000 245808.45 245808.45 0.00 4893.46 4893.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.00 82.44% 5561.23 5029 5917 5564.67 5474 5672 172377 172377 0.00
crit 6.60 17.56% 11122.99 10059 11834 11109.61 0 11834 73431 73431 0.00
 
 

Action details: demonfire

Static Values
  • id:270481
  • school:shadowflame
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:270481
  • name:Demonfire
  • school:shadowflame
  • tooltip:
  • description:Deal {$s1=0} Shadowflame damage to your enemy target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.357500
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - illidari_satyr 1243 / 189
melee 408 0.4% 47.3 2.71sec 388 326 Direct 47.3 330 659 388 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 0.00 0.00 1.1921 0.0000 18365.93 26256.31 30.05 325.88 325.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.87 82.21% 329.89 281 376 329.33 285 370 12821 18330 30.05
crit 8.41 17.79% 659.26 562 753 650.55 0 753 5545 7927 29.69
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 204 0.2% 47.3 2.71sec 194 154 Direct 47.3 165 330 194 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 0.00 0.00 1.2615 0.0000 9180.34 13124.40 30.05 153.93 153.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.89 82.25% 164.93 141 188 164.61 0 185 6413 9169 30.04
crit 8.39 17.75% 329.77 281 376 324.64 0 376 2767 3956 29.63
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Shadow Slash 630 0.6% 10.2 12.76sec 2797 2797 Direct 10.2 2375 4753 2797 17.7%  

Stats details: shadow_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.21 10.21 0.00 0.00 1.0000 0.0000 28565.67 28565.67 0.00 2796.72 2796.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.40 82.28% 2375.42 2026 2711 2368.99 0 2668 19963 19963 0.00
crit 1.81 17.72% 4752.69 4053 5422 3720.23 0 5422 8603 8603 0.00
 
 

Action details: shadow_slash

Static Values
  • id:272012
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272012
  • name:Shadow Slash
  • school:shadow
  • tooltip:
  • description:The Satyr strikes at out with its weapons, dealing Shadow damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - darkhound 1277 / 194
Fel Bite 461 0.4% 10.0 13.17sec 2089 2090 Direct 10.0 1779 3556 2090 17.5%  

Stats details: fel_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.97 9.97 0.00 0.00 1.0000 0.0000 20822.43 29768.16 30.05 2089.56 2089.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.22 82.53% 1779.05 1519 2032 1774.38 0 2032 14631 20916 29.98
crit 1.74 17.47% 3555.68 3037 4064 2718.59 0 4064 6192 8852 22.97
 
 

Action details: fel_bite

Static Values
  • id:272435
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272435
  • name:Fel Bite
  • school:physical
  • tooltip:
  • description:The Darkhound bites its target, causing serious Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 815 0.7% 47.1 2.71sec 776 650 Direct 47.1 659 1319 776 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.13 47.13 0.00 0.00 1.1940 0.0000 36554.20 52258.62 30.05 649.60 649.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.83 82.40% 659.44 562 753 658.52 569 753 25608 36610 30.05
crit 8.30 17.60% 1319.49 1125 1505 1296.81 0 1505 10946 15649 29.58
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - vicious_hellhound 1041 / 158
Demon Fangs 647 0.6% 10.5 12.62sec 2793 2793 Direct 10.5 2372 4745 2793 17.7%  

Stats details: demon_fangs

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.48 10.48 0.00 0.00 1.0000 0.0000 29252.78 29252.78 0.00 2792.63 2792.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.62 82.28% 2372.12 2026 2711 2365.79 0 2711 20445 20445 0.00
crit 1.86 17.72% 4745.26 4053 5422 3722.54 0 5422 8808 8808 0.00
 
 

Action details: demon_fangs

Static Values
  • id:272013
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272013
  • name:Demon Fangs
  • school:shadowflame
  • tooltip:
  • description:The Vicious Hellhound chomps at its target, dealing Shadowflame damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
melee 394 0.3% 91.2 1.40sec 194 318 Direct 91.2 165 330 194 17.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.21 91.21 0.00 0.00 0.6117 0.0000 17725.18 25340.28 30.05 317.71 317.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.12 82.36% 165.21 141 188 164.87 142 184 12411 17743 30.05
crit 16.09 17.64% 330.38 281 376 328.63 0 376 5314 7598 29.95
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
pet - shivarra 1903 / 291
melee 819 0.7% 47.8 2.71sec 776 650 Direct 47.8 659 1319 776 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.82 47.82 0.00 0.00 1.1953 0.0000 37127.88 53078.77 30.05 649.57 649.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.33 82.26% 659.48 562 753 658.61 569 748 25940 37085 30.05
crit 8.48 17.74% 1318.74 1125 1505 1304.78 0 1505 11187 15994 29.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
melee_oh 409 0.4% 47.8 2.71sec 388 307 Direct 47.8 330 659 388 17.7%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.82 47.82 0.00 0.00 1.2649 0.0000 18561.09 26535.31 30.05 306.87 306.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.34 82.28% 329.73 281 376 329.27 283 376 12973 18547 30.05
crit 8.47 17.72% 659.48 562 753 650.51 0 753 5588 7989 29.67
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
Multi-Slash 0 (104) 0.0% (0.6%) 0.0 0.00sec 0 3928

Stats details: multislash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 3927.78 3927.78
 
 

Action details: multislash

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (1) 169 0.2% 7.8 17.58sec 984 0 Direct 7.8 835 1672 984 17.7%  

Stats details: multislash1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 7693.96 10999.44 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.43 82.26% 835.16 717 959 830.81 0 959 5374 7682 29.90
crit 1.39 17.74% 1672.24 1434 1919 1206.49 0 1919 2320 3317 21.70
 
 

Action details: multislash1

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (2) 168 0.2% 7.8 17.58sec 980 0 Direct 7.8 835 1672 980 17.3%  

Stats details: multislash2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 7666.92 10960.78 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.47 82.67% 835.17 717 959 832.18 0 959 5401 7721 29.96
crit 1.36 17.33% 1672.19 1434 1919 1191.18 0 1919 2266 3240 21.39
 
 

Action details: multislash2

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (3) 169 0.2% 7.8 17.58sec 983 0 Direct 7.8 836 1668 983 17.7%  

Stats details: multislash3

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 7687.30 10989.92 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.44 82.32% 835.58 717 959 833.07 0 959 5380 7692 29.98
crit 1.38 17.68% 1668.36 1434 1919 1202.51 0 1919 2307 3298 21.65
 
 

Action details: multislash3

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
    Multi-Slash (4) 168 0.2% 7.8 17.58sec 981 0 Direct 7.8 835 1670 981 17.4%  

Stats details: multislash4

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 7671.01 10966.63 30.05 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.46 82.59% 835.41 717 959 833.43 0 959 5397 7715 29.99
crit 1.36 17.41% 1669.97 1434 1919 1189.71 0 1919 2274 3251 21.42
 
 

Action details: multislash4

Static Values
  • id:272172
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272172
  • name:Multi-Slash
  • school:physical
  • tooltip:
  • description:The Shivarra stabs wildly at her target with all weapons at the same time, dealing physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00
 
pet - void_terror 1801 / 273
Double Breath 0 (149) 0.0% (0.9%) 0.0 0.00sec 0 7316

Stats details: double_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 7315.56 7315.56
 
 

Action details: double_breath

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (1) 490 0.4% 7.9 16.83sec 2784 0 Direct 7.9 2366 4741 2784 17.6%  

Stats details: double_breath1

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.91 7.91 0.00 0.00 0.0000 0.0000 22010.91 22010.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.52 82.42% 2366.38 2026 2711 2355.49 0 2646 15422 15422 0.00
crit 1.39 17.58% 4740.67 4053 5422 3432.69 0 5422 6589 6589 0.00
 
 

Action details: double_breath1

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
    Double Breath (2) 490 0.4% 7.9 16.83sec 2789 0 Direct 7.9 2367 4738 2789 17.8%  

Stats details: double_breath2

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.91 7.91 0.00 0.00 0.0000 0.0000 22050.69 22050.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.50 82.20% 2366.69 2026 2711 2360.63 0 2711 15383 15383 0.00
crit 1.41 17.80% 4737.71 4053 5422 3344.85 0 5422 6668 6668 0.00
 
 

Action details: double_breath2

Static Values
  • id:272156
  • school:shadowflame
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272156
  • name:Double Breath
  • school:shadowflame
  • tooltip:
  • description:The Void Terror unleashes a breath of Fire and Shadow at the target, dealing Shadowflame damage.
 
melee 821 0.7% 47.4 2.67sec 777 650 Direct 47.4 660 1319 777 17.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.39 47.39 0.00 0.00 1.1941 0.0000 36800.43 52610.63 30.05 650.32 650.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.99 82.28% 659.80 562 753 658.97 565 741 25727 36779 30.05
crit 8.40 17.72% 1318.74 1125 1505 1299.76 0 1505 11074 15831 29.65
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:2.00
 
pet - eye_of_guldan 979 / 85
Eye of Gul'dan 979 0.5% 29.2 4.89sec 860 1128 Periodic 62.9 400 0 400 0.0% 61.7%

Stats details: eye_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.23 0.00 62.93 62.93 0.7631 2.9407 25153.49 25153.49 0.00 121.30 1127.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.9 100.00% 399.70 81 484 398.48 350 430 25153 25153 0.00
 
 

Action details: eye_of_guldan

Static Values
  • id:272131
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272131
  • name:Eye of Gul'dan
  • school:shadowflame
  • tooltip:Suffering Shadow damage every $t1 sec.
  • description:The Eye of Gul'dan stares deep into the target's soul, causing Shadow Damage every $t1 sec for {$d=15 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
pet - prince_malchezaar 4568 / 395
melee 3051 1.5% 21.1 1.45sec 3680 3081 Direct 21.1 3126 6242 3680 17.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.10 21.10 0.00 0.00 1.1946 0.0000 77646.09 111004.40 30.05 3080.95 3080.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.35 82.21% 3125.97 2665 3566 3117.58 2696 3502 54220 77514 30.05
crit 3.75 17.79% 6242.47 5330 7131 6000.97 0 7047 23426 33490 28.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
melee_oh 1518 0.8% 21.1 1.45sec 1834 1450 Direct 21.1 1562 3129 1834 17.3%  

Stats details: melee_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.10 21.10 0.00 0.00 1.2646 0.0000 38685.43 55305.46 30.05 1450.03 1450.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.44 82.68% 1562.11 1333 1783 1557.78 1347 1746 27248 38954 30.05
crit 3.65 17.32% 3129.42 2665 3566 2979.71 0 3481 11438 16352 28.67
 
 

Action details: melee_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
 
Simple Action Stats Execute Interval
DStr_ID_Imp
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
Berserking 2.0 186.93sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:pet.demonic_tyrant.active|target.time_to_die<=15
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Call Dreadstalkers 14.6 21.04sec

Stats details: call_dreadstalkers

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.58 0.00 0.00 0.00 1.2033 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: call_dreadstalkers

Static Values
  • id:104316
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2.0
  • secondary_cost:0.0
  • cooldown:20.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
Spelldata
  • id:104316
  • name:Call Dreadstalkers
  • school:shadow
  • tooltip:
  • description:Summons {$s1=2} ferocious Dreadstalkers to attack the target for {$193332d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:DStr_ID_Imp
  • harmful:false
  • if_expr:
 
inner_demons 1.0 0.00sec

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: inner_demons

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.inner_demons.enabled
 
Nether Portal 2.0 0.00sec

Stats details: nether_portal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.2382 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nether_portal

Static Values
  • id:267217
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
Spelldata
  • id:267217
  • name:Nether Portal
  • school:shadow
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Summon Demonic Tyrant 3.6 93.51sec

Stats details: summon_demonic_tyrant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 1.5072 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_demonic_tyrant

Static Values
  • id:265187
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:2000.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
Spelldata
  • id:265187
  • name:Summon Demonic Tyrant
  • school:shadow
  • tooltip:
  • description:Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.
 
Summon Imp 1.0 0.00sec

Stats details: summon_imp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_imp

Static Values
  • id:688
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:688
  • name:Summon Imp
  • school:shadow
  • tooltip:
  • description:Summons an Imp under your command that casts ranged Firebolts.
 
summon_random_demon 17.8 14.76sec

Stats details: summon_random_demon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_random_demon

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 
Summon Vilefiend 6.8 47.17sec

Stats details: summon_vilefiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 0.00 0.00 1.5520 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: summon_vilefiend

Static Values
  • id:264119
  • school:fire
  • resource:soul_shard
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
Spelldata
  • id:264119
  • name:Summon Vilefiend
  • school:fire
  • tooltip:
  • description:Summon a Vilefiend to fight for you for the next {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Archive of the Titans 1.0 59.5 0.0sec 5.0sec 100.00% 0.00% 40.5(40.5) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_archive_of_the_titans
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:28.00

Stack Uptimes

  • archive_of_the_titans_1:1.69%
  • archive_of_the_titans_2:1.69%
  • archive_of_the_titans_3:1.69%
  • archive_of_the_titans_4:1.69%
  • archive_of_the_titans_5:1.69%
  • archive_of_the_titans_6:1.69%
  • archive_of_the_titans_7:1.69%
  • archive_of_the_titans_8:1.69%
  • archive_of_the_titans_9:1.69%
  • archive_of_the_titans_10:1.69%
  • archive_of_the_titans_11:1.69%
  • archive_of_the_titans_12:1.69%
  • archive_of_the_titans_13:1.69%
  • archive_of_the_titans_14:1.69%
  • archive_of_the_titans_15:1.69%
  • archive_of_the_titans_16:1.69%
  • archive_of_the_titans_17:1.69%
  • archive_of_the_titans_18:1.69%
  • archive_of_the_titans_19:1.69%
  • archive_of_the_titans_20:67.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:280709
  • name:Archive of the Titans
  • tooltip:Your $?$w1!=0[Agility]?$w2!=0[Intellect]?$w3!=0[Strength][primary stat] is increased by $w4.
  • description:{$@spelldesc280555=Your armor gathers and analyzes combat data every $280708t1 sec, increasing your primary stat by {$s1=7}, stacking up to {$280709u=20} times. The data decays while out of combat. Enables $@spellname280573 within Uldir.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 100.9sec 0.0sec 16.22% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 186.9sec 186.9sec 6.76% 8.51% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demonic Calling 12.8 15.5 23.3sec 10.2sec 52.08% 83.64% 15.5(15.5) 0.1

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_calling_1:52.08%

Trigger Attempt Success

  • trigger_pct:19.94%

Spelldata details

  • id:205146
  • name:Demonic Calling
  • tooltip:Your next Call Dreadstalkers costs {$205145s1=1} less Soul Shard and has no cast time.
  • description:{$@spelldesc205145=Shadow Bolt{$?s264178=true}[ and Demonbolt have][ has] a {$h=20}% chance to make your next Call Dreadstalkers cost {$s1=1} less Soul Shard and have no cast time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Demonic Core 24.5 32.1 11.7sec 5.0sec 40.27% 100.00% 4.8(4.8) 0.4

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_core
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_core_1:16.47%
  • demonic_core_2:15.88%
  • demonic_core_3:5.41%
  • demonic_core_4:2.52%

Trigger Attempt Success

  • trigger_pct:23.57%

Spelldata details

  • id:264173
  • name:Demonic Core
  • tooltip:The cast time of Demonbolt is reduced by {$s1=100}%.
  • description:{$@spelldesc267102=When your Wild Imps expend all of their energy or are imploded, you have a {$s1=10}% chance to absorb their life essence, granting you a stack of Demonic Core. When your summoned Dreadstalkers fade away, you have a {$s2=100}% chance to absorb their life essence, granting you a stack of Demonic Core. Demonic Core reduces the cast time of Demonbolt by {$264173s1=100}%. Maximum {$264173u=4} stacks.}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Demonic Power 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_demonic_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • demonic_power_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:265273
  • name:Demonic Power
  • tooltip:Damage dealt by your demons increased by {$s2=15}%.
  • description:{$@spelldesc265187=Summon a Demonic Tyrant to increase the duration of all of your current demons by ${$265273m3/1000}.1 sec, and increase the damage of all of your other demons by {$265273s2=15}%, while damaging your target.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
dreadstalkers 11.6 17.6 26.7sec 10.2sec 65.94% 0.00% 0.0(0.0) 10.9

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_dreadstalkers
  • max_stacks:4
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • dreadstalkers_2:59.59%
  • dreadstalkers_4:6.35%

Trigger Attempt Success

  • trigger_pct:100.00%
eyes_of_guldan 0.2 0.5 157.7sec 2.7sec 1.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_eyes_of_guldan
  • max_stacks:4
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • eyes_of_guldan_4:1.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Ignition Mage's Fuse 2.4 0.0 171.6sec 171.6sec 14.82% 0.00% 2.0(2.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:275.80

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:2.88%
  • ignition_mages_fuse_5:2.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Nether Portal 2.0 0.0 182.9sec 0.0sec 10.14% 17.97% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_nether_portal
  • max_stacks:1
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • nether_portal_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267217
  • name:Nether Portal
  • tooltip:
  • description:Tear open a portal to the Twisting Nether for {$d=15 seconds}. Every time you spend Soul Shards, you will also command demons from the Nether to come out and fight for you.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Overwhelming Power 4.3 3.0 67.1sec 36.7sec 44.20% 0.00% 3.0(40.9) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • overwhelming_power_1:1.30%
  • overwhelming_power_2:1.33%
  • overwhelming_power_3:1.37%
  • overwhelming_power_4:1.40%
  • overwhelming_power_5:1.44%
  • overwhelming_power_6:1.48%
  • overwhelming_power_7:1.52%
  • overwhelming_power_8:1.56%
  • overwhelming_power_9:1.60%
  • overwhelming_power_10:1.64%
  • overwhelming_power_11:1.69%
  • overwhelming_power_12:1.73%
  • overwhelming_power_13:1.78%
  • overwhelming_power_14:1.83%
  • overwhelming_power_15:1.88%
  • overwhelming_power_16:1.93%
  • overwhelming_power_17:1.99%
  • overwhelming_power_18:2.04%
  • overwhelming_power_19:2.10%
  • overwhelming_power_20:2.16%
  • overwhelming_power_21:2.22%
  • overwhelming_power_22:2.28%
  • overwhelming_power_23:2.34%
  • overwhelming_power_24:2.40%
  • overwhelming_power_25:1.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
portal_summons 2.0 13.4 182.9sec 14.5sec 19.52% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_portal_summons
  • max_stacks:40
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • portal_summons_1:1.70%
  • portal_summons_2:0.78%
  • portal_summons_3:1.24%
  • portal_summons_4:1.53%
  • portal_summons_5:1.86%
  • portal_summons_6:1.82%
  • portal_summons_7:3.97%
  • portal_summons_8:5.86%
  • portal_summons_9:0.77%

Trigger Attempt Success

  • trigger_pct:100.00%
prince_malchezaar 0.2 0.0 152.4sec 81.4sec 1.45% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_prince_malchezaar
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • prince_malchezaar_1:1.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Quick Navigation 6.0 22.4 52.2sec 10.3sec 67.50% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_quick_navigation
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:50.00

Stack Uptimes

  • quick_navigation_1:17.73%
  • quick_navigation_2:17.06%
  • quick_navigation_3:16.64%
  • quick_navigation_4:16.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268887
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Quick Navigation (_final) 5.3 0.0 52.1sec 52.1sec 17.50% 0.00% 0.0(0.0) 5.2

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_quick_navigation_final
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:600.00

Stack Uptimes

  • quick_navigation_final_1:17.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:268893
  • name:Quick Navigation
  • tooltip:Increases Haste by $w1.
  • description:{$@spelldesc268894=Permanently enchant a weapon to sometimes increase Haste by $268887s for {$268887d=30 seconds}, stacking up to 5 times. Upon reaching 5 stacks, all stacks are consumed to grant you $268893s Haste for {$268893d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Supreme Commander 4.3 0.1 82.5sec 79.8sec 17.02% 0.00% 0.1(0.1) 3.3

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_supreme_commander
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:838.00

Stack Uptimes

  • supreme_commander_1:17.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279878
  • name:Supreme Commander
  • tooltip:
  • description:When your Demonic Tyrant expires, consume its life essence, granting you a stack of Demonic Core and increasing your Intellect by {$s1=398} for {$279885d=15 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
tyrant 3.6 0.0 93.5sec 93.5sec 17.61% 0.00% 0.0(0.0) 3.5

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_tyrant
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • tyrant_1:17.61%

Trigger Attempt Success

  • trigger_pct:100.00%
vilefiend 6.8 0.0 47.2sec 47.2sec 49.97% 0.00% 0.0(0.0) 6.4

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_vilefiend
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • vilefiend_1:49.97%

Trigger Attempt Success

  • trigger_pct:100.00%
wild_imps 2.0 188.2 132.1sec 0.0sec 97.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_wild_imps
  • max_stacks:40
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • wild_imps_1:1.43%
  • wild_imps_2:2.04%
  • wild_imps_3:10.38%
  • wild_imps_4:20.89%
  • wild_imps_5:8.09%
  • wild_imps_6:14.83%
  • wild_imps_7:18.54%
  • wild_imps_8:5.05%
  • wild_imps_9:3.54%
  • wild_imps_10:3.96%
  • wild_imps_11:4.19%
  • wild_imps_12:1.73%
  • wild_imps_13:1.22%
  • wild_imps_14:1.28%
  • wild_imps_15:0.36%
  • wild_imps_16:0.16%
  • wild_imps_17:0.06%
  • wild_imps_18:0.01%
  • wild_imps_19:0.00%
  • wild_imps_20:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Inner Demons

Buff details

  • buff initial source:DStr_ID_Imp
  • cooldown name:buff_inner_demons
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:12.00

Stack Uptimes

  • inner_demons_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267216
  • name:Inner Demons
  • tooltip:
  • description:You passively summon a Wild Imp to fight for you every $t1 sec, and have a {$s1=10}% chance to also summon an additional Demon to fight for you for {$s2=15} sec.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
summon_random_demon 17.8 13.9sec
one_shard_hog 9.0 21.8sec
two_shard_hog 4.2 48.4sec
three_shard_hog 49.7 5.7sec
portal_summon 15.4 13.7sec

Resources

Resource Usage Type Count Total Average RPE APR
DStr_ID_Imp
call_dreadstalkers Soul Shard 14.6 17.0 1.2 1.2 0.0
demonbolt Mana 48.0 96071.2 2000.0 2042.4 4.2
hand_of_guldan Soul Shard 62.9 166.5 2.6 2.6 1976.8
shadow_bolt Mana 94.0 188021.2 2000.0 2000.0 2.1
summon_demonic_tyrant Mana 3.6 7155.7 2000.0 2000.1 0.0
summon_vilefiend Soul Shard 6.8 6.8 1.0 1.0 0.0
pet - imp
firebolt Energy 103.8 4152.7 40.0 40.0 226.5
pet - wild_imp
fel_firebolt Energy 1217.8 18639.7 15.3 15.3 49.0
Resource Gains Type Count Total Average Overflow
demonbolt Soul Shard 48.04 95.94 (50.51%) 2.00 0.13 0.14%
shadow_bolt Soul Shard 94.01 94.00 (49.49%) 1.00 0.01 0.01%
mana_regen Mana 557.28 288374.58 (100.00%) 517.47 11075.06 3.70%
pet - imp
energy_regen Energy 425.70 3981.61 (100.00%) 9.35 22.74 0.57%
pet - bilescourge
energy_regen Energy 11.86 0.00 (0.00%) 0.00 164.31 100.00%
pet - bilescourge
energy_regen Energy 13.91 0.00 (0.00%) 0.00 192.67 100.00%
pet - demonic_tyrant
energy_regen Energy 37.67 0.00 (0.00%) 0.00 760.24 100.00%
pet - bilescourge
energy_regen Energy 12.79 0.00 (0.00%) 0.00 176.40 100.00%
pet - bilescourge
energy_regen Energy 12.15 0.00 (0.00%) 0.00 168.92 100.00%
pet - bilescourge
energy_regen Energy 7.79 0.00 (0.00%) 0.00 107.45 100.00%
pet - bilescourge
energy_regen Energy 0.91 0.00 (0.00%) 0.00 12.75 100.00%
Resource RPS-Gain RPS-Loss
Mana 961.30 970.88
Soul Shard 0.63 0.63
Combat End Resource Mean Min Max
Mana 97146.85 92407.00 100000.00
Soul Shard 2.64 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%

Statistics & Data Analysis

Fight Length
Sample Data DStr_ID_Imp Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data DStr_ID_Imp Damage Per Second
Count 4999
Mean 17027.95
Minimum 15515.36
Maximum 19235.95
Spread ( max - min ) 3720.59
Range [ ( max - min ) / 2 * 100% ] 10.92%
Standard Deviation 555.5666
5th Percentile 16184.62
95th Percentile 18011.56
( 95th Percentile - 5th Percentile ) 1826.93
Mean Distribution
Standard Deviation 7.8577
95.00% Confidence Intervall ( 17012.55 - 17043.35 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4090
0.1 Scale Factor Error with Delta=300 2635
0.05 Scale Factor Error with Delta=300 10540
0.01 Scale Factor Error with Delta=300 263485
Priority Target DPS
Sample Data DStr_ID_Imp Priority Target Damage Per Second
Count 4999
Mean 17027.95
Minimum 15515.36
Maximum 19235.95
Spread ( max - min ) 3720.59
Range [ ( max - min ) / 2 * 100% ] 10.92%
Standard Deviation 555.5666
5th Percentile 16184.62
95th Percentile 18011.56
( 95th Percentile - 5th Percentile ) 1826.93
Mean Distribution
Standard Deviation 7.8577
95.00% Confidence Intervall ( 17012.55 - 17043.35 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4090
0.1 Scale Factor Error with Delta=300 2635
0.05 Scale Factor Error with Delta=300 10540
0.01 Scale Factor Error with Delta=300 263485
DPS(e)
Sample Data DStr_ID_Imp Damage Per Second (Effective)
Count 4999
Mean 17027.95
Minimum 15515.36
Maximum 19235.95
Spread ( max - min ) 3720.59
Range [ ( max - min ) / 2 * 100% ] 10.92%
Damage
Sample Data DStr_ID_Imp Damage
Count 4999
Mean 1271367.30
Minimum 916520.56
Maximum 1655993.65
Spread ( max - min ) 739473.09
Range [ ( max - min ) / 2 * 100% ] 29.08%
DTPS
Sample Data DStr_ID_Imp Damage Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data DStr_ID_Imp Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data DStr_ID_Imp Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data DStr_ID_Imp Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data DStr_ID_Imp Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data DStr_ID_Imp Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data DStr_ID_ImpTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data DStr_ID_Imp Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 summon_pet
4 0.00 inner_demons,if=talent.inner_demons.enabled
5 0.00 snapshot_stats
6 0.00 potion
7 0.00 demonbolt
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,if=pet.demonic_tyrant.active|target.time_to_die<30
9 2.37 use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
A 2.00 berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
0.00 doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
0.00 demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
B 0.00 call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
C 0.00 call_action_list,name=implosion,if=spell_targets.implosion>1
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
D 4.87 summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
E 11.56 call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
F 1.59 summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
0.00 doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
G 46.21 hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
0.00 soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
H 42.92 demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
0.00 bilescourge_bombers
I 0.00 call_action_list,name=build_a_shard
actions.build_a_shard
# count action,conditions
0.00 demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
0.00 soul_strike
J 94.51 shadow_bolt
actions.nether_portal_active
# count action,conditions
0.00 grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
N 2.00 summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
O 2.00 call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
P 0.00 call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
Q 14.43 hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
R 1.96 summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
S 0.04 summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
T 4.12 demonbolt,if=buff.demonic_core.up
U 0.00 call_action_list,name=build_a_shard
actions.nether_portal_building
# count action,conditions
V 2.00 nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
W 1.02 call_dreadstalkers
X 0.54 hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
0.00 power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
Y 1.92 hand_of_guldan,if=soul_shard>=5
Z 0.00 call_action_list,name=build_a_shard

Sample Sequence

0123467VNOQJQR9AJQJQJQJQJQJQJJJJEGHJGJJHGHGJHGHHJGHJEHDGHGJJJGJHGHHJGEHGHHGJJGJJJJJGHJEGHHDGHF8GHJGJJJEJGJHGHHGHGHHJGEHGJJJJJDGHHGHJEGJJGJJJJJYJJWJXJJJJJVQQTNQR9ATOQJQJQJQJJJGHHGHJJEGHGJJJGJJHGHJJEDGHHGHGJJHGHJJEGHGJJJGJJHGHJJEGHGHJDFHGJJJJEGJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 1 food DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 2 augmentation DStr_ID_Imp 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 3 summon_imp Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 4 inner_demons Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard
Pre precombat 6 potion Fluffy_Pillow 100000.0/100000: 100% mana | 3.0/5: 60% soul_shard battle_potion_of_intellect
0:00.000 precombat 7 demonbolt Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard battle_potion_of_intellect
0:00.000 nether_portal_building V nether_portal Fluffy_Pillow 98000.0/100000: 98% mana | 5.0/5: 100% soul_shard archive_of_the_titans, battle_potion_of_intellect
0:01.276 nether_portal_active N summon_vilefiend Fluffy_Pillow 99276.0/100000: 99% mana | 5.0/5: 100% soul_shard bloodlust, nether_portal, portal_summons, archive_of_the_titans, battle_potion_of_intellect
0:02.583 nether_portal_active O call_dreadstalkers Fluffy_Pillow 100000.0/100000: 100% mana | 4.0/5: 80% soul_shard bloodlust, nether_portal, vilefiend, portal_summons(2), archive_of_the_titans, battle_potion_of_intellect
0:03.891 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 2.0/5: 40% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(3), archive_of_the_titans, battle_potion_of_intellect
0:04.876 build_a_shard J shadow_bolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, dreadstalkers(2), vilefiend, portal_summons(4), archive_of_the_titans, battle_potion_of_intellect
0:06.185 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard bloodlust, nether_portal, wild_imps, dreadstalkers(2), vilefiend, portal_summons(4), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:07.162 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 98982.0/100000: 99% mana | 0.0/5: 0% soul_shard bloodlust, nether_portal, wild_imps(2), dreadstalkers(2), vilefiend, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.464 default 9 use_items Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect
0:08.464 default A berserking Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.464 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.558 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97100.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(5), quick_navigation, archive_of_the_titans(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.379 build_a_shard J shadow_bolt Fluffy_Pillow 97921.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.473 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97015.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(3), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:12.294 build_a_shard J shadow_bolt Fluffy_Pillow 97836.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(5), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse
0:13.387 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96929.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.180 build_a_shard J shadow_bolt Fluffy_Pillow 97722.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, nether_portal, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.240 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96782.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:16.036 build_a_shard J shadow_bolt Fluffy_Pillow 97578.0/100000: 98% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:17.096 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96638.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.870 build_a_shard J shadow_bolt Fluffy_Pillow 97412.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, berserking, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.897 nether_portal_active Q hand_of_guldan Fluffy_Pillow 96439.0/100000: 96% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.783 build_a_shard J shadow_bolt Fluffy_Pillow 97325.0/100000: 97% mana | 0.0/5: 0% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:20.963 build_a_shard J shadow_bolt Fluffy_Pillow 96505.0/100000: 97% mana | 1.0/5: 20% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.109 build_a_shard J shadow_bolt Fluffy_Pillow 95651.0/100000: 96% mana | 2.0/5: 40% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:23.253 build_a_shard J shadow_bolt Fluffy_Pillow 94795.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(4)
0:24.396 default E call_dreadstalkers Fluffy_Pillow 93938.0/100000: 94% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, demonic_calling, supreme_commander, wild_imps(11), dreadstalkers(2), vilefiend, portal_summons(8), quick_navigation, archive_of_the_titans(5), ignition_mages_fuse(4)
0:25.256 default G hand_of_guldan Fluffy_Pillow 94798.0/100000: 95% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation, archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.089 default H demonbolt Fluffy_Pillow 95631.0/100000: 96% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:26.919 build_a_shard J shadow_bolt Fluffy_Pillow 94461.0/100000: 94% mana | 2.0/5: 40% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.026 default G hand_of_guldan Fluffy_Pillow 93568.0/100000: 94% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(11), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6), ignition_mages_fuse(5)
0:28.856 build_a_shard J shadow_bolt Fluffy_Pillow 94398.0/100000: 94% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, portal_summons(8), quick_navigation(2), archive_of_the_titans(6)
0:30.147 build_a_shard J shadow_bolt Fluffy_Pillow 93689.0/100000: 94% mana | 1.0/5: 20% soul_shard bloodlust, supreme_commander, wild_imps(4), dreadstalkers(4), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:31.439 default H demonbolt Fluffy_Pillow 92981.0/100000: 93% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:32.409 default G hand_of_guldan Fluffy_Pillow 91951.0/100000: 92% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(7)
0:33.379 default H demonbolt Fluffy_Pillow 92921.0/100000: 93% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(7)
0:34.349 default G hand_of_guldan Fluffy_Pillow 91891.0/100000: 92% mana | 3.0/5: 60% soul_shard bloodlust, supreme_commander, wild_imps(3), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(7)
0:35.319 build_a_shard J shadow_bolt Fluffy_Pillow 92861.0/100000: 93% mana | 0.0/5: 0% soul_shard bloodlust, supreme_commander, wild_imps(5), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(8)
0:36.604 default H demonbolt Fluffy_Pillow 92146.0/100000: 92% mana | 1.0/5: 20% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(7), quick_navigation(3), archive_of_the_titans(8)
0:37.568 default G hand_of_guldan Fluffy_Pillow 91110.0/100000: 91% mana | 3.0/5: 60% soul_shard bloodlust, demonic_core(3), supreme_commander, wild_imps(7), quick_navigation(3), archive_of_the_titans(8)
0:38.533 default H demonbolt Fluffy_Pillow 92075.0/100000: 92% mana | 0.0/5: 0% soul_shard bloodlust, demonic_core(3), wild_imps(7), quick_navigation(3), archive_of_the_titans(8)
0:39.495 default H demonbolt Fluffy_Pillow 91037.0/100000: 91% mana | 2.0/5: 40% soul_shard bloodlust, demonic_core(2), wild_imps(7), quick_navigation(3), archive_of_the_titans(8)
0:40.460 build_a_shard J shadow_bolt Fluffy_Pillow 90002.0/100000: 90% mana | 4.0/5: 80% soul_shard bloodlust, demonic_core, wild_imps(10), quick_navigation(3), overwhelming_power(24), archive_of_the_titans(9)
0:41.582 default G hand_of_guldan Fluffy_Pillow 89124.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(8), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(9)
0:42.676 default H demonbolt Fluffy_Pillow 90218.0/100000: 90% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(9)
0:43.774 build_a_shard J shadow_bolt Fluffy_Pillow 89316.0/100000: 89% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(9)
0:45.246 default E call_dreadstalkers Fluffy_Pillow 88788.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(6), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(10)
0:46.734 default H demonbolt Fluffy_Pillow 90276.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(5), dreadstalkers(2), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(10)
0:47.856 default D summon_vilefiend Fluffy_Pillow 89398.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), quick_navigation(4), overwhelming_power(17), archive_of_the_titans(10)
0:49.360 default G hand_of_guldan Fluffy_Pillow 90902.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(10)
0:50.501 default H demonbolt Fluffy_Pillow 92043.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(25), archive_of_the_titans(11)
0:51.582 default G hand_of_guldan Fluffy_Pillow 91124.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(24), archive_of_the_titans(11)
0:52.669 build_a_shard J shadow_bolt Fluffy_Pillow 92211.0/100000: 92% mana | 0.0/5: 0% soul_shard wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(23), archive_of_the_titans(11)
0:54.123 build_a_shard J shadow_bolt Fluffy_Pillow 91665.0/100000: 92% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(21), archive_of_the_titans(11)
0:55.594 build_a_shard J shadow_bolt Fluffy_Pillow 91136.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(20), archive_of_the_titans(12)
0:57.073 default G hand_of_guldan Fluffy_Pillow 90615.0/100000: 91% mana | 3.0/5: 60% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(18), archive_of_the_titans(12)
0:58.196 build_a_shard J shadow_bolt Fluffy_Pillow 91738.0/100000: 92% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power(17), archive_of_the_titans(12)
0:59.699 default H demonbolt Fluffy_Pillow 91241.0/100000: 91% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(16), archive_of_the_titans(12)
1:00.834 default G hand_of_guldan Fluffy_Pillow 90376.0/100000: 90% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(7), vilefiend, quick_navigation(4), overwhelming_power(15), archive_of_the_titans(13)
1:01.975 default H demonbolt Fluffy_Pillow 91517.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core(2), wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(14), archive_of_the_titans(13)
1:03.122 default H demonbolt Fluffy_Pillow 90664.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(5), vilefiend, quick_navigation(4), overwhelming_power(12), archive_of_the_titans(13)
1:04.284 build_a_shard J shadow_bolt Fluffy_Pillow 89826.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation(4), overwhelming_power(11), archive_of_the_titans(13)
1:05.843 default G hand_of_guldan Fluffy_Pillow 89385.0/100000: 89% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(14)
1:06.965 default E call_dreadstalkers Fluffy_Pillow 90507.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(14)
1:08.096 default H demonbolt Fluffy_Pillow 91638.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(7), archive_of_the_titans(14)
1:09.238 default G hand_of_guldan Fluffy_Pillow 90780.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(14)
1:10.383 default H demonbolt Fluffy_Pillow 91925.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(15)
1:11.539 default H demonbolt Fluffy_Pillow 91081.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(15)
1:12.700 default G hand_of_guldan Fluffy_Pillow 90242.0/100000: 90% mana | 4.0/5: 80% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(15)
1:13.867 build_a_shard J shadow_bolt Fluffy_Pillow 91409.0/100000: 91% mana | 1.0/5: 20% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(15)
1:15.430 build_a_shard J shadow_bolt Fluffy_Pillow 90972.0/100000: 91% mana | 2.0/5: 40% soul_shard wild_imps(9), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(16)
1:17.013 default G hand_of_guldan Fluffy_Pillow 90555.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(16)
1:18.288 build_a_shard J shadow_bolt Fluffy_Pillow 91830.0/100000: 92% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), archive_of_the_titans(16)
1:19.988 build_a_shard J shadow_bolt Fluffy_Pillow 91530.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(7), archive_of_the_titans(16)
1:21.687 build_a_shard J shadow_bolt Fluffy_Pillow 91229.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(6), archive_of_the_titans(17)
1:23.387 build_a_shard J shadow_bolt Fluffy_Pillow 90929.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(5), overwhelming_power(25), archive_of_the_titans(17)
1:24.858 build_a_shard J shadow_bolt Fluffy_Pillow 90400.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), overwhelming_power(24), archive_of_the_titans(17)
1:26.338 default G hand_of_guldan Fluffy_Pillow 89880.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), overwhelming_power(22), archive_of_the_titans(18)
1:27.459 default H demonbolt Fluffy_Pillow 91001.0/100000: 91% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, wild_imps(3), quick_navigation, overwhelming_power(21), archive_of_the_titans(18)
1:28.581 build_a_shard J shadow_bolt Fluffy_Pillow 90123.0/100000: 90% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(2), quick_navigation, overwhelming_power(20), archive_of_the_titans(18)
1:30.084 default E call_dreadstalkers Fluffy_Pillow 89626.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation, overwhelming_power(18), archive_of_the_titans(19)
1:31.226 default G hand_of_guldan Fluffy_Pillow 90768.0/100000: 91% mana | 4.0/5: 80% soul_shard demonic_core(3), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(17), archive_of_the_titans(19)
1:32.372 default H demonbolt Fluffy_Pillow 91914.0/100000: 92% mana | 1.0/5: 20% soul_shard demonic_core(3), wild_imps(3), dreadstalkers(2), quick_navigation, overwhelming_power(16), archive_of_the_titans(19)
1:33.527 default H demonbolt Fluffy_Pillow 91069.0/100000: 91% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(15), archive_of_the_titans(19)
1:34.688 default D summon_vilefiend Fluffy_Pillow 90230.0/100000: 90% mana | 5.0/5: 100% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation, overwhelming_power(14), archive_of_the_titans(19)
1:36.244 default G hand_of_guldan Fluffy_Pillow 91786.0/100000: 92% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(12), archive_of_the_titans(20)
1:37.425 default H demonbolt Fluffy_Pillow 92967.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(11), archive_of_the_titans(20)
1:38.613 default F summon_demonic_tyrant Fluffy_Pillow 92155.0/100000: 92% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(10), archive_of_the_titans(20)
1:40.205 default 8 potion Fluffy_Pillow 91747.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(8), archive_of_the_titans(20)
1:40.205 default G hand_of_guldan Fluffy_Pillow 91747.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, overwhelming_power(8), archive_of_the_titans(20), battle_potion_of_intellect
1:41.415 default H demonbolt Fluffy_Pillow 92957.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(7), archive_of_the_titans(20), battle_potion_of_intellect
1:42.623 build_a_shard J shadow_bolt Fluffy_Pillow 92165.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(6), archive_of_the_titans(20), battle_potion_of_intellect
1:44.242 default G hand_of_guldan Fluffy_Pillow 91784.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(4), archive_of_the_titans(20), battle_potion_of_intellect
1:45.473 build_a_shard J shadow_bolt Fluffy_Pillow 93015.0/100000: 93% mana | 0.0/5: 0% soul_shard demonic_power, demonic_calling, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power(3), archive_of_the_titans(20), battle_potion_of_intellect
1:47.125 build_a_shard J shadow_bolt Fluffy_Pillow 92667.0/100000: 93% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), overwhelming_power, archive_of_the_titans(20), battle_potion_of_intellect
1:48.795 build_a_shard J shadow_bolt Fluffy_Pillow 92337.0/100000: 92% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:50.474 default E call_dreadstalkers Fluffy_Pillow 92016.0/100000: 92% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:51.735 build_a_shard J shadow_bolt Fluffy_Pillow 93277.0/100000: 93% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(12), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:53.414 default G hand_of_guldan Fluffy_Pillow 92956.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_power, wild_imps(12), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:54.674 build_a_shard J shadow_bolt Fluffy_Pillow 94216.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_power, wild_imps(12), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:56.355 default H demonbolt Fluffy_Pillow 93897.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), dreadstalkers(4), vilefiend, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:57.615 default G hand_of_guldan Fluffy_Pillow 93157.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation(2), archive_of_the_titans(20), battle_potion_of_intellect
1:58.875 default H demonbolt Fluffy_Pillow 94417.0/100000: 94% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(14), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:00.128 default H demonbolt Fluffy_Pillow 93670.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(15), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:01.381 default G hand_of_guldan Fluffy_Pillow 92923.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(17), dreadstalkers(2), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:02.633 default H demonbolt Fluffy_Pillow 94175.0/100000: 94% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(11), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:03.885 default G hand_of_guldan Fluffy_Pillow 93427.0/100000: 93% mana | 3.0/5: 60% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(8), vilefiend, quick_navigation(3), archive_of_the_titans(20), battle_potion_of_intellect
2:05.134 default H demonbolt Fluffy_Pillow 94676.0/100000: 95% mana | 0.0/5: 0% soul_shard demonic_core(3), demonic_calling, supreme_commander, wild_imps(7), vilefiend, quick_navigation(4), archive_of_the_titans(20), battle_potion_of_intellect
2:06.378 default H demonbolt Fluffy_Pillow 93920.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(8), quick_navigation(4), archive_of_the_titans(20)
2:07.622 build_a_shard J shadow_bolt Fluffy_Pillow 93164.0/100000: 93% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(10), quick_navigation(4), archive_of_the_titans(20)
2:09.282 default G hand_of_guldan Fluffy_Pillow 92824.0/100000: 93% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
2:10.528 default E call_dreadstalkers Fluffy_Pillow 94070.0/100000: 94% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(6), quick_navigation(4), archive_of_the_titans(20)
2:11.772 default H demonbolt Fluffy_Pillow 95314.0/100000: 95% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:13.016 default G hand_of_guldan Fluffy_Pillow 94558.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:14.262 build_a_shard J shadow_bolt Fluffy_Pillow 95804.0/100000: 96% mana | 0.0/5: 0% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:15.921 build_a_shard J shadow_bolt Fluffy_Pillow 95463.0/100000: 95% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:17.580 build_a_shard J shadow_bolt Fluffy_Pillow 95122.0/100000: 95% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:19.241 build_a_shard J shadow_bolt Fluffy_Pillow 94783.0/100000: 95% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:20.901 build_a_shard J shadow_bolt Fluffy_Pillow 94443.0/100000: 94% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:22.559 default D summon_vilefiend Fluffy_Pillow 94101.0/100000: 94% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation(4), archive_of_the_titans(20)
2:24.219 default G hand_of_guldan Fluffy_Pillow 95761.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
2:25.465 default H demonbolt Fluffy_Pillow 97007.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps, vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:26.652 default H demonbolt Fluffy_Pillow 96194.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:27.840 default G hand_of_guldan Fluffy_Pillow 95382.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:29.029 default H demonbolt Fluffy_Pillow 96571.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, wild_imps(4), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:30.215 build_a_shard J shadow_bolt Fluffy_Pillow 95757.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(5), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:31.797 default E call_dreadstalkers Fluffy_Pillow 95339.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(7), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:32.985 default G hand_of_guldan Fluffy_Pillow 96527.0/100000: 97% mana | 4.0/5: 80% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:34.171 build_a_shard J shadow_bolt Fluffy_Pillow 97713.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
2:35.753 build_a_shard J shadow_bolt Fluffy_Pillow 97295.0/100000: 97% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
2:37.453 default G hand_of_guldan Fluffy_Pillow 96995.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
2:38.731 build_a_shard J shadow_bolt Fluffy_Pillow 98273.0/100000: 98% mana | 0.0/5: 0% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, archive_of_the_titans(20)
2:40.430 build_a_shard J shadow_bolt Fluffy_Pillow 97972.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation, archive_of_the_titans(20)
2:42.121 build_a_shard J shadow_bolt Fluffy_Pillow 97663.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), archive_of_the_titans(20)
2:43.800 build_a_shard J shadow_bolt Fluffy_Pillow 97342.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(6), quick_navigation(2), archive_of_the_titans(20)
2:45.479 build_a_shard J shadow_bolt Fluffy_Pillow 97021.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:47.158 nether_portal_building Y hand_of_guldan Fluffy_Pillow 96700.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core(2), wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:48.420 build_a_shard J shadow_bolt Fluffy_Pillow 97962.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:50.100 build_a_shard J shadow_bolt Fluffy_Pillow 97642.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), wild_imps(3), quick_navigation(2), archive_of_the_titans(20)
2:51.780 nether_portal_building W call_dreadstalkers Fluffy_Pillow 97322.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), quick_navigation(2), archive_of_the_titans(20)
2:53.477 build_a_shard J shadow_bolt Fluffy_Pillow 99019.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:55.147 nether_portal_building X hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:56.398 build_a_shard J shadow_bolt Fluffy_Pillow 99256.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(3), archive_of_the_titans(20)
2:58.069 build_a_shard J shadow_bolt Fluffy_Pillow 98006.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
2:59.729 build_a_shard J shadow_bolt Fluffy_Pillow 97666.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(3), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:01.387 build_a_shard J shadow_bolt Fluffy_Pillow 97324.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:03.047 build_a_shard J shadow_bolt Fluffy_Pillow 96984.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:04.707 nether_portal_building V nether_portal Fluffy_Pillow 96644.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_calling, wild_imps(4), dreadstalkers(2), quick_navigation(4), archive_of_the_titans(20)
3:05.952 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97889.0/100000: 98% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps(3), portal_summons, quick_navigation(4), archive_of_the_titans(20)
3:07.198 nether_portal_active Q hand_of_guldan Fluffy_Pillow 99135.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, nether_portal, wild_imps, portal_summons(2), quick_navigation(4), overwhelming_power(25), archive_of_the_titans(20)
3:08.280 nether_portal_active T demonbolt Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_calling, nether_portal, portal_summons(3), quick_navigation(4), overwhelming_power(24), archive_of_the_titans(20)
3:09.367 nether_portal_active N summon_vilefiend Fluffy_Pillow 99087.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(3), portal_summons(3), quick_navigation(4), overwhelming_power(23), archive_of_the_titans(20)
3:10.823 nether_portal_active Q hand_of_guldan Fluffy_Pillow 100000.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(4), quick_navigation(4), overwhelming_power(22), archive_of_the_titans(20)
3:11.922 nether_portal_active R summon_demonic_tyrant Fluffy_Pillow 100000.0/100000: 100% mana | 0.0/5: 0% soul_shard demonic_core, demonic_calling, nether_portal, wild_imps(5), vilefiend, portal_summons(5), quick_navigation(4), overwhelming_power(21), archive_of_the_titans(20)
3:13.394 default 9 use_items Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20)
3:13.394 default A berserking Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse
3:13.394 nether_portal_active T demonbolt Fluffy_Pillow 98005.0/100000: 98% mana | 0.0/5: 0% soul_shard berserking, demonic_core, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(4), overwhelming_power(19), archive_of_the_titans(20), ignition_mages_fuse
3:14.338 nether_portal_active O call_dreadstalkers Fluffy_Pillow 96949.0/100000: 97% mana | 2.0/5: 40% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(7), vilefiend, tyrant, portal_summons(5), quick_navigation(4), overwhelming_power(18), archive_of_the_titans(20), ignition_mages_fuse
3:15.288 nether_portal_active Q hand_of_guldan Fluffy_Pillow 97899.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(6), quick_navigation_final, overwhelming_power(17), archive_of_the_titans(20), ignition_mages_fuse
3:16.203 build_a_shard J shadow_bolt Fluffy_Pillow 98814.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(16), archive_of_the_titans(20), ignition_mages_fuse
3:17.428 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(7), quick_navigation_final, overwhelming_power(15), archive_of_the_titans(20), ignition_mages_fuse(2)
3:18.326 build_a_shard J shadow_bolt Fluffy_Pillow 98903.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, nether_portal, wild_imps(8), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(14), archive_of_the_titans(20), ignition_mages_fuse(2)
3:19.529 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, nether_portal, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(13), archive_of_the_titans(20), ignition_mages_fuse(2)
3:20.435 build_a_shard J shadow_bolt Fluffy_Pillow 98911.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(9), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(12), archive_of_the_titans(20), ignition_mages_fuse(2)
3:21.650 nether_portal_active Q hand_of_guldan Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(11), archive_of_the_titans(20), ignition_mages_fuse(3)
3:22.543 build_a_shard J shadow_bolt Fluffy_Pillow 98898.0/100000: 99% mana | 0.0/5: 0% soul_shard berserking, demonic_power, demonic_calling, wild_imps(10), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(10), archive_of_the_titans(20), ignition_mages_fuse(3)
3:23.735 build_a_shard J shadow_bolt Fluffy_Pillow 98003.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_power, demonic_calling, wild_imps(11), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), quick_navigation_final, overwhelming_power(9), archive_of_the_titans(20), ignition_mages_fuse(3)
3:25.114 build_a_shard J shadow_bolt Fluffy_Pillow 97382.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_power, demonic_calling, wild_imps(12), dreadstalkers(2), vilefiend, tyrant, portal_summons(8), overwhelming_power(7), archive_of_the_titans(20), ignition_mages_fuse(3)
3:26.596 default G hand_of_guldan Fluffy_Pillow 96864.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(12), vilefiend, tyrant, portal_summons(8), overwhelming_power(6), archive_of_the_titans(20), ignition_mages_fuse(4)
3:27.682 default H demonbolt Fluffy_Pillow 97950.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core(2), demonic_power, demonic_calling, wild_imps(12), vilefiend, tyrant, portal_summons(8), overwhelming_power(5), archive_of_the_titans(20), ignition_mages_fuse(4)
3:28.775 default H demonbolt Fluffy_Pillow 97043.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, supreme_commander, wild_imps(13), vilefiend, portal_summons(8), overwhelming_power(4), archive_of_the_titans(20), ignition_mages_fuse(4)
3:29.872 default G hand_of_guldan Fluffy_Pillow 96140.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(15), vilefiend, portal_summons(8), overwhelming_power(24), archive_of_the_titans(20), ignition_mages_fuse(5)
3:30.839 default H demonbolt Fluffy_Pillow 97107.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, supreme_commander, wild_imps(14), vilefiend, portal_summons(8), overwhelming_power(23), archive_of_the_titans(20), ignition_mages_fuse(5)
3:31.811 build_a_shard J shadow_bolt Fluffy_Pillow 96079.0/100000: 96% mana | 3.0/5: 60% soul_shard demonic_calling, supreme_commander, wild_imps(11), vilefiend, portal_summons(8), overwhelming_power(22), archive_of_the_titans(20), ignition_mages_fuse(5)
3:33.111 build_a_shard J shadow_bolt Fluffy_Pillow 95379.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_calling, supreme_commander, wild_imps(13), vilefiend, portal_summons(8), overwhelming_power(25), archive_of_the_titans(20), ignition_mages_fuse(5)
3:34.391 default E call_dreadstalkers Fluffy_Pillow 94659.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_calling, supreme_commander, wild_imps(11), vilefiend, overwhelming_power(24), archive_of_the_titans(20)
3:35.502 default G hand_of_guldan Fluffy_Pillow 95770.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, supreme_commander, wild_imps(6), dreadstalkers(2), vilefiend, overwhelming_power(23), archive_of_the_titans(20)
3:36.619 default H demonbolt Fluffy_Pillow 96887.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core, supreme_commander, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(22), archive_of_the_titans(20)
3:37.736 default G hand_of_guldan Fluffy_Pillow 96004.0/100000: 96% mana | 3.0/5: 60% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(21), archive_of_the_titans(20)
3:38.860 build_a_shard J shadow_bolt Fluffy_Pillow 97128.0/100000: 97% mana | 0.0/5: 0% soul_shard supreme_commander, wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(20), archive_of_the_titans(20)
3:40.364 build_a_shard J shadow_bolt Fluffy_Pillow 96632.0/100000: 97% mana | 1.0/5: 20% soul_shard supreme_commander, wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation, overwhelming_power(18), archive_of_the_titans(20)
3:41.883 build_a_shard J shadow_bolt Fluffy_Pillow 96151.0/100000: 96% mana | 2.0/5: 40% soul_shard supreme_commander, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
3:43.403 default G hand_of_guldan Fluffy_Pillow 95671.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(15), archive_of_the_titans(20)
3:44.560 build_a_shard J shadow_bolt Fluffy_Pillow 96828.0/100000: 97% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(14), archive_of_the_titans(20)
3:46.108 build_a_shard J shadow_bolt Fluffy_Pillow 96376.0/100000: 96% mana | 1.0/5: 20% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(12), archive_of_the_titans(20)
3:47.674 default H demonbolt Fluffy_Pillow 95942.0/100000: 96% mana | 2.0/5: 40% soul_shard demonic_core(2), wild_imps(6), quick_navigation(2), overwhelming_power(11), archive_of_the_titans(20)
3:48.855 default G hand_of_guldan Fluffy_Pillow 95123.0/100000: 95% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), quick_navigation(2), overwhelming_power(10), archive_of_the_titans(20)
3:50.042 default H demonbolt Fluffy_Pillow 96310.0/100000: 96% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), quick_navigation(3), overwhelming_power(8), archive_of_the_titans(20)
3:51.237 build_a_shard J shadow_bolt Fluffy_Pillow 95505.0/100000: 96% mana | 3.0/5: 60% soul_shard wild_imps(5), quick_navigation(3), overwhelming_power(7), archive_of_the_titans(20)
3:52.839 build_a_shard J shadow_bolt Fluffy_Pillow 95107.0/100000: 95% mana | 4.0/5: 80% soul_shard wild_imps(7), quick_navigation(4), overwhelming_power(6), archive_of_the_titans(20)
3:54.440 default E call_dreadstalkers Fluffy_Pillow 94708.0/100000: 95% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), quick_navigation(4), overwhelming_power(4), archive_of_the_titans(20)
3:55.657 default D summon_vilefiend Fluffy_Pillow 95925.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation(4), overwhelming_power(3), archive_of_the_titans(20)
3:57.448 default G hand_of_guldan Fluffy_Pillow 97716.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), overwhelming_power, archive_of_the_titans(20)
3:58.687 default H demonbolt Fluffy_Pillow 98955.0/100000: 99% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(3), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
3:59.932 default H demonbolt Fluffy_Pillow 98200.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(2), dreadstalkers(2), vilefiend, quick_navigation(4), archive_of_the_titans(20)
4:01.177 default G hand_of_guldan Fluffy_Pillow 97445.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:02.364 default H demonbolt Fluffy_Pillow 98632.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:03.552 default G hand_of_guldan Fluffy_Pillow 97820.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:04.741 build_a_shard J shadow_bolt Fluffy_Pillow 99009.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(7), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:06.324 build_a_shard J shadow_bolt Fluffy_Pillow 98005.0/100000: 98% mana | 1.0/5: 20% soul_shard wild_imps(9), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:07.905 default H demonbolt Fluffy_Pillow 97586.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core(2), demonic_calling, wild_imps(8), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:09.090 default G hand_of_guldan Fluffy_Pillow 96771.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:10.278 default H demonbolt Fluffy_Pillow 97959.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(20)
4:11.553 build_a_shard J shadow_bolt Fluffy_Pillow 97234.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(6), vilefiend, archive_of_the_titans(20)
4:13.252 build_a_shard J shadow_bolt Fluffy_Pillow 96933.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_calling, wild_imps(7), archive_of_the_titans(20)
4:14.951 default E call_dreadstalkers Fluffy_Pillow 96632.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_core, demonic_calling, wild_imps(4), archive_of_the_titans(20)
4:16.228 default G hand_of_guldan Fluffy_Pillow 97909.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), archive_of_the_titans(20)
4:17.505 default H demonbolt Fluffy_Pillow 99186.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_core, wild_imps(4), dreadstalkers(2), quick_navigation, overwhelming_power(25), archive_of_the_titans(20)
4:18.605 default G hand_of_guldan Fluffy_Pillow 98286.0/100000: 98% mana | 3.0/5: 60% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation, overwhelming_power(24), archive_of_the_titans(20)
4:19.711 build_a_shard J shadow_bolt Fluffy_Pillow 99392.0/100000: 99% mana | 0.0/5: 0% soul_shard wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(23), archive_of_the_titans(20)
4:21.182 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_calling, wild_imps(5), dreadstalkers(2), quick_navigation(2), overwhelming_power(21), archive_of_the_titans(20)
4:22.669 build_a_shard J shadow_bolt Fluffy_Pillow 97491.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_calling, wild_imps(6), dreadstalkers(2), quick_navigation(2), overwhelming_power(20), archive_of_the_titans(20)
4:24.165 default G hand_of_guldan Fluffy_Pillow 96987.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(18), archive_of_the_titans(20)
4:25.301 build_a_shard J shadow_bolt Fluffy_Pillow 98123.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(2), overwhelming_power(17), archive_of_the_titans(20)
4:26.822 build_a_shard J shadow_bolt Fluffy_Pillow 97644.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core, demonic_calling, wild_imps(7), dreadstalkers(2), quick_navigation(3), overwhelming_power(16), archive_of_the_titans(20)
4:28.343 default H demonbolt Fluffy_Pillow 97165.0/100000: 97% mana | 2.0/5: 40% soul_shard demonic_core(4), demonic_calling, wild_imps(6), quick_navigation(3), overwhelming_power(14), archive_of_the_titans(20)
4:29.499 default G hand_of_guldan Fluffy_Pillow 96321.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(13), archive_of_the_titans(20)
4:30.661 default H demonbolt Fluffy_Pillow 97483.0/100000: 97% mana | 1.0/5: 20% soul_shard demonic_core(3), demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(12), archive_of_the_titans(20)
4:31.828 build_a_shard J shadow_bolt Fluffy_Pillow 96650.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core(2), demonic_calling, wild_imps(4), quick_navigation(3), overwhelming_power(11), archive_of_the_titans(20)
4:33.393 build_a_shard J shadow_bolt Fluffy_Pillow 96215.0/100000: 96% mana | 4.0/5: 80% soul_shard demonic_core(2), demonic_calling, wild_imps(6), quick_navigation(4), overwhelming_power(9), archive_of_the_titans(20)
4:34.967 default E call_dreadstalkers Fluffy_Pillow 95789.0/100000: 96% mana | 5.0/5: 100% soul_shard demonic_core(2), demonic_calling, wild_imps(3), quick_navigation_final, overwhelming_power(8), archive_of_the_titans(20)
4:36.103 default G hand_of_guldan Fluffy_Pillow 96925.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(6), archive_of_the_titans(20)
4:37.249 default H demonbolt Fluffy_Pillow 98071.0/100000: 98% mana | 1.0/5: 20% soul_shard demonic_core(2), wild_imps(4), dreadstalkers(2), quick_navigation_final, overwhelming_power(5), archive_of_the_titans(20)
4:38.405 default G hand_of_guldan Fluffy_Pillow 97227.0/100000: 97% mana | 3.0/5: 60% soul_shard demonic_core, wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(4), archive_of_the_titans(20)
4:39.563 default H demonbolt Fluffy_Pillow 98385.0/100000: 98% mana | 0.0/5: 0% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), quick_navigation_final, overwhelming_power(3), archive_of_the_titans(20)
4:40.731 build_a_shard J shadow_bolt Fluffy_Pillow 97553.0/100000: 98% mana | 2.0/5: 40% soul_shard wild_imps(5), dreadstalkers(2), quick_navigation_final, overwhelming_power(2), archive_of_the_titans(20)
4:42.296 default D summon_vilefiend Fluffy_Pillow 97118.0/100000: 97% mana | 3.0/5: 60% soul_shard wild_imps(7), dreadstalkers(2), quick_navigation_final, archive_of_the_titans(20)
4:44.025 default F summon_demonic_tyrant Fluffy_Pillow 98847.0/100000: 99% mana | 2.0/5: 40% soul_shard demonic_core, wild_imps(6), dreadstalkers(2), vilefiend, quick_navigation_final, archive_of_the_titans(20)
4:45.606 default H demonbolt Fluffy_Pillow 98003.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_core, demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:46.882 default G hand_of_guldan Fluffy_Pillow 97279.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, archive_of_the_titans(20)
4:48.158 build_a_shard J shadow_bolt Fluffy_Pillow 98555.0/100000: 99% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(4), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:49.847 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(6), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:51.537 build_a_shard J shadow_bolt Fluffy_Pillow 97694.0/100000: 98% mana | 3.0/5: 60% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:53.226 build_a_shard J shadow_bolt Fluffy_Pillow 97383.0/100000: 97% mana | 4.0/5: 80% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:54.916 default E call_dreadstalkers Fluffy_Pillow 97073.0/100000: 97% mana | 5.0/5: 100% soul_shard demonic_power, demonic_calling, wild_imps(7), dreadstalkers(2), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:56.236 default G hand_of_guldan Fluffy_Pillow 98393.0/100000: 98% mana | 4.0/5: 80% soul_shard demonic_power, wild_imps(7), dreadstalkers(4), vilefiend, tyrant, quick_navigation, archive_of_the_titans(20)
4:57.504 build_a_shard J shadow_bolt Fluffy_Pillow 99661.0/100000: 100% mana | 1.0/5: 20% soul_shard demonic_power, wild_imps(7), dreadstalkers(4), vilefiend, tyrant, quick_navigation(2), archive_of_the_titans(20)
4:59.183 build_a_shard J shadow_bolt Fluffy_Pillow 98004.0/100000: 98% mana | 2.0/5: 40% soul_shard demonic_power, wild_imps(9), dreadstalkers(4), vilefiend, tyrant, quick_navigation(3), archive_of_the_titans(20)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 9026 8206 7205
Intellect 1467 -3 8475 7287 5476 (377)
Spirit 0 0 0 0 0
Health 180520 164120 0
Mana 100000 100000 0
Soul Shard 5 5 0
Spell Power 8475 7287 0
Crit 17.68% 17.68% 913
Haste 17.90% 17.90% 1217
Damage / Heal Versatility 1.52% 1.52% 129
ManaReg per Second 1000 1000 0
Mastery 26.55% 26.55% 742
Armor 1159 1159 1159
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 385.00
Local Head Horrific Amalgam's Hood
ilevel: 390, stats: { 154 Armor, +655 Int, +1189 Sta }
azerite powers: { Supreme Commander, Overwhelming Power, Azerite Empowered }
Local Neck Heart of Azeroth
ilevel: 389, stats: { +251 Haste, +251 Crit, +251 Mastery, +326 Sta, +192 StrAgiInt }
Local Shoulders Amice of Corrupting Horror
ilevel: 390, stats: { 142 Armor, +491 Int, +892 Sta }
azerite powers: { Archive of the Titans, Heed My Call, Azerite Empowered }
Local Chest Robes of the Unraveler
ilevel: 390, stats: { 189 Armor, +655 Int, +1189 Sta }
azerite powers: { Archive of the Titans, Overwhelming Power, Azerite Empowered }
Local Waist Cord of Septic Envelopment
ilevel: 385, stats: { 103 Armor, +247 Int, +417 Sta, +115 Haste, +68 Crit }
Local Legs Leggings of Lingering Infestation
ilevel: 385, stats: { 160 Armor, +329 Int, +556 Sta, +133 Haste, +112 Mastery }
Local Feet Volatile Walkers
ilevel: 385, stats: { 126 Armor, +247 Int, +417 Sta, +111 Crit, +72 Vers }
Local Wrists Void-Lashed Wristband
ilevel: 385, stats: { 80 Armor, +185 Int, +312 Sta, +81 Mastery, +57 Vers }
Local Hands Mutagenic Protofluid Handwraps
ilevel: 385, stats: { 114 Armor, +247 Int, +417 Sta, +111 Crit, +72 Haste }
Local Finger1 Rot-Scour Ring
ilevel: 385, stats: { +312 Sta, +302 Crit, +129 Haste }, enchant: { +37 Haste }
Local Finger2 Band of Certain Annihilation
ilevel: 385, stats: { +312 Sta, +234 Haste, +197 Mastery }, enchant: { +37 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 370, stats: { +271 Int }
Local Trinket2 Vigilant's Bloodshaper
ilevel: 385, stats: { +313 Int }
Local Back Fetid Horror's Tanglecloak
ilevel: 385, stats: { 91 Armor, +185 StrAgiInt, +312 Sta, +92 Haste, +45 Mastery }
Local Main Hand Tusk of the Reborn Prophet
ilevel: 385, weapon: { 126 - 211, 1.8 }, stats: { +164 Int, +277 Sta, +70 Crit, +51 Haste, +792 Int }, enchant: quick_navigation
Local Off Hand Codex of Imminent Ruin
ilevel: 385, stats: { +277 Sta, +66 Haste, +56 Mastery, +503 Int }

Talents

Level
15 Dreadlash (Demonology Warlock) Demonic Strength (Demonology Warlock) Bilescourge Bombers (Demonology Warlock)
30 Demonic Calling (Demonology Warlock) Power Siphon (Demonology Warlock) Doom (Demonology Warlock)
45 Demon Skin Burning Rush Dark Pact
60 From the Shadows (Demonology Warlock) Soul Strike (Demonology Warlock) Summon Vilefiend (Demonology Warlock)
75 Darkfury Mortal Coil Demonic Circle
90 Soul Conduit (Demonology Warlock) Inner Demons (Demonology Warlock) Grimoire: Felguard (Demonology Warlock)
100 Sacrificed Souls (Demonology Warlock) Demonic Consumption (Demonology Warlock) Nether Portal (Demonology Warlock)

Profile

warlock="DStr_ID_Imp"
source=default
spec=demonology
level=120
race=troll
role=spell
position=ranged_back
talents=2103023

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/summon_pet
actions.precombat+=/inner_demons,if=talent.inner_demons.enabled
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/demonbolt

# Executed every time the actor is available.
actions=potion,if=pet.demonic_tyrant.active|target.time_to_die<30
actions+=/use_items,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/berserking,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/blood_fury,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/fireblood,if=pet.demonic_tyrant.active|target.time_to_die<=15
actions+=/doom,if=!ticking&time_to_die>30&spell_targets.implosion<2
actions+=/demonic_strength,if=(buff.wild_imps.stack<6|buff.demonic_power.up)|spell_targets.implosion<2
actions+=/call_action_list,name=nether_portal,if=talent.nether_portal.enabled&spell_targets.implosion<=2
actions+=/call_action_list,name=implosion,if=spell_targets.implosion>1
actions+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions+=/summon_vilefiend,if=equipped.132369|cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions+=/call_dreadstalkers,if=equipped.132369|(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions+=/summon_demonic_tyrant,if=equipped.132369|(buff.dreadstalkers.remains>cast_time&(buff.wild_imps.stack>=3+talent.inner_demons.enabled+talent.demonic_consumption.enabled*3|prev_gcd.1.hand_of_guldan&(!talent.demonic_consumption.enabled|buff.wild_imps.stack>=3+talent.inner_demons.enabled))&(soul_shard<3|buff.dreadstalkers.remains<gcd*2.7|buff.grimoire_felguard.remains<gcd*2.7))
actions+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&spell_targets.implosion<2
actions+=/doom,if=talent.doom.enabled&refreshable&time_to_die>(dot.doom.remains+30)
actions+=/hand_of_guldan,if=soul_shard>=5|(soul_shard>=3&cooldown.call_dreadstalkers.remains>4&(!talent.summon_vilefiend.enabled|cooldown.summon_vilefiend.remains>3))
actions+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&((cooldown.summon_demonic_tyrant.remains<10|cooldown.summon_demonic_tyrant.remains>22)|buff.demonic_core.stack>=3|buff.demonic_core.remains<5|time_to_die<25)
actions+=/bilescourge_bombers
actions+=/call_action_list,name=build_a_shard

actions.build_a_shard=demonbolt,if=azerite.forbidden_knowledge.enabled&buff.forbidden_knowledge.react&!buff.demonic_core.react&cooldown.summon_demonic_tyrant.remains>20
actions.build_a_shard+=/soul_strike
actions.build_a_shard+=/shadow_bolt

actions.implosion=implosion,if=(buff.wild_imps.stack>=6&(soul_shard<3|prev_gcd.1.call_dreadstalkers|buff.wild_imps.stack>=9|prev_gcd.1.bilescourge_bombers|(!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan))&!prev_gcd.1.hand_of_guldan&!prev_gcd.2.hand_of_guldan&buff.demonic_power.down)|(time_to_die<3&buff.wild_imps.stack>0)|(prev_gcd.2.call_dreadstalkers&buff.wild_imps.stack>2&!talent.demonic_calling.enabled)
actions.implosion+=/grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.implosion+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.implosion+=/summon_demonic_tyrant
actions.implosion+=/hand_of_guldan,if=soul_shard>=5
actions.implosion+=/hand_of_guldan,if=soul_shard>=3&(((prev_gcd.2.hand_of_guldan|buff.wild_imps.stack>=3)&buff.wild_imps.stack<9)|cooldown.summon_demonic_tyrant.remains<=gcd*2|buff.demonic_power.remains>gcd*2)
actions.implosion+=/demonbolt,if=prev_gcd.1.hand_of_guldan&soul_shard>=1&(buff.wild_imps.stack<=3|prev_gcd.3.hand_of_guldan)&soul_shard<4&buff.demonic_core.up
actions.implosion+=/summon_vilefiend,if=(cooldown.summon_demonic_tyrant.remains>40&spell_targets.implosion<=2)|cooldown.summon_demonic_tyrant.remains<12
actions.implosion+=/bilescourge_bombers,if=cooldown.summon_demonic_tyrant.remains>9
actions.implosion+=/soul_strike,if=soul_shard<5&buff.demonic_core.stack<=2
actions.implosion+=/demonbolt,if=soul_shard<=3&buff.demonic_core.up&(buff.demonic_core.stack>=3|buff.demonic_core.remains<=gcd*5.7)
actions.implosion+=/doom,cycle_targets=1,max_cycle_targets=7,if=refreshable
actions.implosion+=/call_action_list,name=build_a_shard

actions.nether_portal=call_action_list,name=nether_portal_building,if=cooldown.nether_portal.remains<20
actions.nether_portal+=/call_action_list,name=nether_portal_active,if=cooldown.nether_portal.remains>160

actions.nether_portal_active=grimoire_felguard,if=cooldown.summon_demonic_tyrant.remains<13|!equipped.132369
actions.nether_portal_active+=/summon_vilefiend,if=cooldown.summon_demonic_tyrant.remains>40|cooldown.summon_demonic_tyrant.remains<12
actions.nether_portal_active+=/call_dreadstalkers,if=(cooldown.summon_demonic_tyrant.remains<9&buff.demonic_calling.remains)|(cooldown.summon_demonic_tyrant.remains<11&!buff.demonic_calling.remains)|cooldown.summon_demonic_tyrant.remains>14
actions.nether_portal_active+=/call_action_list,name=build_a_shard,if=soul_shard=1&(cooldown.call_dreadstalkers.remains<action.shadow_bolt.cast_time|(talent.bilescourge_bombers.enabled&cooldown.bilescourge_bombers.remains<action.shadow_bolt.cast_time))
actions.nether_portal_active+=/hand_of_guldan,if=((cooldown.call_dreadstalkers.remains>action.demonbolt.cast_time)&(cooldown.call_dreadstalkers.remains>action.shadow_bolt.cast_time))&cooldown.nether_portal.remains>(160+action.hand_of_guldan.cast_time)
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<10&soul_shard=0
actions.nether_portal_active+=/summon_demonic_tyrant,if=buff.nether_portal.remains<action.summon_demonic_tyrant.cast_time+5.5
actions.nether_portal_active+=/demonbolt,if=buff.demonic_core.up
actions.nether_portal_active+=/call_action_list,name=build_a_shard

actions.nether_portal_building=nether_portal,if=soul_shard>=5&(!talent.power_siphon.enabled|buff.demonic_core.up)
actions.nether_portal_building+=/call_dreadstalkers
actions.nether_portal_building+=/hand_of_guldan,if=cooldown.call_dreadstalkers.remains>18&soul_shard>=3
actions.nether_portal_building+=/power_siphon,if=buff.wild_imps.stack>=2&buff.demonic_core.stack<=2&buff.demonic_power.down&soul_shard>=3
actions.nether_portal_building+=/hand_of_guldan,if=soul_shard>=5
actions.nether_portal_building+=/call_action_list,name=build_a_shard

head=horrific_amalgams_hood,id=160616,bonus_id=4824/1507/4775,azerite_powers=458/30/13
neck=heart_of_azeroth,id=158075,bonus_id=4929/4930/4936/1536,azerite_level=33
shoulders=amice_of_corrupting_horror,id=160726,bonus_id=4824/1507/4775,azerite_powers=483/22/13
back=fetid_horrors_tanglecloak,id=160643,bonus_id=4800/1507
chest=robes_of_the_unraveler,id=160614,bonus_id=4824/1507/4775,azerite_powers=483/30/13
wrists=voidlashed_wristband,id=160617,bonus_id=4800/1507
hands=mutagenic_protofluid_handwraps,id=160715,bonus_id=4800/1507
waist=cord_of_septic_envelopment,id=160727,bonus_id=4800/1507
legs=leggings_of_lingering_infestation,id=160615,bonus_id=4800/1507
feet=volatile_walkers,id=160714,bonus_id=4800/1507
finger1=rotscour_ring,id=160645,bonus_id=4800/1507,enchant=pact_of_haste
finger2=band_of_certain_annihilation,id=160646,bonus_id=4800/1507,enchant=pact_of_haste
trinket1=ignition_mages_fuse,id=159615,bonus_id=1542/4779
trinket2=vigilants_bloodshaper,id=160651,bonus_id=4800/1507
main_hand=tusk_of_the_reborn_prophet,id=160691,bonus_id=4800/1507,enchant=quick_navigation
off_hand=codex_of_imminent_ruin,id=160696,bonus_id=4800/1507

# Gear Summary
# gear_ilvl=385.25
# gear_stamina=7205
# gear_intellect=5476
# gear_crit_rating=913
# gear_haste_rating=1217
# gear_mastery_rating=742
# gear_versatility_rating=129
# gear_armor=1159
default_pet=Imp

Simulation & Raid Information

Iterations: 5003
Threads: 4
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 257620161
Max Event Queue: 1003
Sim Seconds: 1500833
CPU Seconds: 446.2813
Physical Seconds: 112.9483
Speed Up: 3363

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
DL_GF_Felguard DL_GF_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.39sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard demonbolt 264178 376711 1256 9.01 7110 14217 44.2 45.0 17.6% 0.0% 0.0% 0.0% 6.21sec 376711 299.99sec
DL_GF_Felguard DL_GF_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.72sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard hand_of_guldan 105174 315506 1052 12.06 4450 8881 60.4 60.3 17.6% 0.0% 0.0% 0.0% 4.89sec 315506 299.99sec
DL_GF_Felguard DL_GF_Felguard heed_my_call 271685 42450 142 1.47 4925 9849 7.3 7.3 17.4% 0.0% 0.0% 0.0% 36.35sec 42450 299.99sec
DL_GF_Felguard DL_GF_Felguard heed_my_call_aoe 271686 18285 61 1.47 2111 4221 7.3 7.3 18.0% 0.0% 0.0% 0.0% 36.35sec 18285 299.99sec
DL_GF_Felguard DL_GF_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard shadow_bolt 686 401918 1340 19.01 3595 7189 95.7 95.0 17.7% 0.0% 0.0% 0.0% 3.05sec 401918 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.57sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.63sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.24sec 0 299.99sec
DL_GF_Felguard DL_GF_Felguard volatile_blood_explosion 278057 86817 289 1.44 10240 20481 7.3 7.2 17.6% 0.0% 0.0% 0.0% 37.11sec 86817 299.99sec
DL_GF_Felguard DL_GF_Felguard_felguard felstorm ticks -89751 113336 378 12.42 1553 3105 10.4 62.1 17.6% 0.0% 0.0% 0.0% 30.14sec 162027 299.99sec
DL_GF_Felguard DL_GF_Felguard_felguard legion_strike 30213 317984 1060 11.68 4625 9253 58.4 58.4 17.7% 0.0% 0.0% 0.0% 5.09sec 454596 299.99sec
DL_GF_Felguard DL_GF_Felguard_felguard melee 0 517024 1723 34.74 2529 5059 173.7 173.7 17.7% 0.0% 0.0% 0.0% 1.71sec 739147 299.99sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.12sec 0 64.41sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard felstorm ticks -89751 41984 140 3.89 1829 3660 3.9 19.5 17.8% 0.0% 0.0% 0.0% 80.77sec 60021 64.41sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard legion_strike 30213 118961 1847 17.19 5477 10953 18.5 18.5 17.7% 0.0% 0.0% 0.0% 13.91sec 170069 64.41sec
DL_GF_Felguard DL_GF_Felguard_grimoire_felguard melee 0 145472 2258 38.14 3020 6042 40.9 40.9 17.6% 0.0% 0.0% 0.0% 6.34sec 207970 64.41sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.76sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath1 272156 19978 2047 43.77 2389 4773 7.1 7.1 17.5% 0.0% 0.0% 0.0% 17.49sec 19978 9.76sec
DL_GF_Felguard DL_GF_Felguard_void_terror double_breath2 272156 20008 2050 43.77 2388 4784 7.1 7.1 17.6% 0.0% 0.0% 0.0% 17.49sec 20008 9.76sec
DL_GF_Felguard DL_GF_Felguard_void_terror melee 0 33861 3469 265.71 665 1331 43.2 43.2 17.8% 0.0% 0.0% 0.0% 2.69sec 48408 9.76sec
DL_GF_Felguard DL_GF_Felguard_urzul many_faced_bite 272439 19765 2361 67.07 1793 3584 9.4 9.4 17.8% 0.0% 0.0% 0.0% 12.44sec 28256 8.37sec
DL_GF_Felguard DL_GF_Felguard_urzul melee 0 33090 3952 302.87 665 1330 42.3 42.3 17.7% 0.0% 0.0% 0.0% 2.66sec 47306 8.37sec
DL_GF_Felguard DL_GF_Felguard_vilefiend bile_spit 267997 71290 503 2.86 8932 17857 6.8 6.8 18.1% 0.0% 0.0% 0.0% 47.24sec 164793 141.74sec
DL_GF_Felguard DL_GF_Felguard_vilefiend bile_spit ticks -267997 93504 312 6.63 2822 0 6.8 33.1 0.0% 0.0% 0.0% 0.0% 47.24sec 164793 141.74sec
DL_GF_Felguard DL_GF_Felguard_vilefiend headbutt 267999 103850 733 12.05 3106 6212 28.5 28.5 17.5% 0.0% 0.0% 0.0% 10.26sec 148467 141.74sec
DL_GF_Felguard DL_GF_Felguard_vilefiend melee 0 184889 1304 43.44 1531 3064 102.6 102.6 17.7% 0.0% 0.0% 0.0% 2.81sec 264321 141.74sec
DL_GF_Felguard DL_GF_Felguard_vicious_hellhound demon_fangs 272013 26441 2454 52.17 2393 4792 9.4 9.4 17.9% 0.0% 0.0% 0.0% 12.35sec 26441 10.77sec
DL_GF_Felguard DL_GF_Felguard_vicious_hellhound melee 0 16274 1511 462.79 167 333 83.1 83.1 17.6% 0.0% 0.0% 0.0% 1.34sec 23266 10.77sec
DL_GF_Felguard DL_GF_Felguard_dreadstalker dreadbite 205196 264201 2444 16.15 7718 15444 29.1 29.1 17.7% 0.0% 0.0% 0.0% 20.93sec 264201 108.11sec
DL_GF_Felguard DL_GF_Felguard_dreadstalker melee 0 456869 4226 173.23 1244 2488 312.1 312.1 17.7% 0.0% 0.0% 0.0% 1.89sec 653149 108.11sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr melee 0 16677 1458 223.69 332 665 42.7 42.7 17.6% 0.0% 0.0% 0.0% 2.62sec 23842 11.44sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr melee_oh 0 8352 730 223.69 166 332 42.7 42.7 17.8% 0.0% 0.0% 0.0% 2.62sec 11940 11.44sec
DL_GF_Felguard DL_GF_Felguard_illidari_satyr shadow_slash 272012 25580 2236 47.66 2396 4791 9.1 9.1 17.5% 0.0% 0.0% 0.0% 12.66sec 25580 11.44sec
DL_GF_Felguard DL_GF_Felguard_wild_imp fel_firebolt 104318 743763 7941 635.56 637 1274 996.3 992.1 17.7% 0.0% 0.0% 0.0% 0.29sec 743763 93.66sec
DL_GF_Felguard DL_GF_Felguard_demonic_tyrant demonfire 270481 246672 4646 42.60 5561 11122 37.8 37.7 17.7% 0.0% 0.0% 0.0% 6.90sec 246672 53.09sec
DL_GF_Felguard DL_GF_Felguard_shivarra melee 0 33325 2806 215.01 665 1330 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.71sec 47642 11.87sec
DL_GF_Felguard DL_GF_Felguard_shivarra melee_oh 0 16659 1403 215.01 333 665 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.71sec 23817 11.87sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 11.87sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash1 272172 6809 573 34.69 844 1689 6.9 6.9 17.5% 0.0% 0.0% 0.0% 18.14sec 9735 11.87sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash2 272172 6818 574 34.69 844 1688 6.9 6.9 17.7% 0.0% 0.0% 0.0% 18.14sec 9747 11.87sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash3 272172 6837 576 34.69 844 1687 6.9 6.9 18.0% 0.0% 0.0% 0.0% 18.14sec 9774 11.87sec
DL_GF_Felguard DL_GF_Felguard_shivarra multislash4 272172 6803 573 34.69 844 1689 6.9 6.9 17.4% 0.0% 0.0% 0.0% 18.14sec 9726 11.87sec
DL_GF_Felguard DL_GF_Felguard_darkhound fel_bite 272435 18768 2793 79.33 1796 3589 8.9 8.9 17.7% 0.0% 0.0% 0.0% 13.44sec 26830 6.72sec
DL_GF_Felguard DL_GF_Felguard_darkhound melee 0 33317 4959 380.24 665 1329 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.72sec 47631 6.72sec
DL_GF_Felguard DL_GF_Felguard_wrathguard melee 0 33097 2704 207.17 665 1330 42.3 42.3 17.8% 0.0% 0.0% 0.0% 2.53sec 47317 12.24sec
DL_GF_Felguard DL_GF_Felguard_wrathguard melee_oh 0 16517 1349 207.17 332 664 42.3 42.3 17.6% 0.0% 0.0% 0.0% 2.53sec 23613 12.24sec
DL_GF_Felguard DL_GF_Felguard_wrathguard overhead_assault 272432 18707 1528 43.42 1795 3588 8.9 8.9 17.7% 0.0% 0.0% 0.0% 12.53sec 26743 12.24sec
DL_GF_Felguard DL_GF_Felguard_bilescourge toxic_bile 272167 153987 10614 225.36 2401 4802 54.5 54.5 17.7% 0.0% 0.0% 0.0% 1.94sec 153987 14.51sec
DL_GF_Felguard DL_GF_Felguard_prince_malchezaar melee 0 78353 5149 83.62 3150 6284 21.2 21.2 17.4% 0.0% 0.0% 0.0% 1.47sec 112016 15.22sec
DL_GF_Felguard DL_GF_Felguard_prince_malchezaar melee_oh 0 39317 2584 83.62 1574 3148 21.2 21.2 17.8% 0.0% 0.0% 0.0% 1.47sec 56208 15.22sec
DL_GF_Felguard DL_GF_Felguard_eye_of_guldan eye_of_guldan ticks -272131 23995 80 11.99 400 0 27.5 59.9 0.0% 0.0% 0.0% 0.0% 5.27sec 23995 17.36sec
DL_GF_Imp DL_GF_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.21sec 0 299.99sec
DL_GF_Imp DL_GF_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.93sec 0 299.99sec
DL_GF_Imp DL_GF_Imp demonbolt 264178 376865 1256 8.99 7110 14227 44.1 45.0 17.9% 0.0% 0.0% 0.0% 6.21sec 376865 299.99sec
DL_GF_Imp DL_GF_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 299.99sec
DL_GF_Imp DL_GF_Imp hand_of_guldan 105174 315391 1051 12.06 4448 8897 60.4 60.3 17.6% 0.0% 0.0% 0.0% 4.89sec 315391 299.99sec
DL_GF_Imp DL_GF_Imp heed_my_call 271685 42696 142 1.47 4925 9849 7.4 7.4 17.8% 0.0% 0.0% 0.0% 35.90sec 42696 299.99sec
DL_GF_Imp DL_GF_Imp heed_my_call_aoe 271686 18274 61 1.47 2111 4221 7.4 7.4 17.6% 0.0% 0.0% 0.0% 35.90sec 18274 299.99sec
DL_GF_Imp DL_GF_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp shadow_bolt 686 402281 1341 19.02 3595 7189 95.8 95.1 17.7% 0.0% 0.0% 0.0% 3.06sec 402281 299.99sec
DL_GF_Imp DL_GF_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.46sec 0 299.99sec
DL_GF_Imp DL_GF_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_GF_Imp DL_GF_Imp summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.67sec 0 299.99sec
DL_GF_Imp DL_GF_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.23sec 0 299.99sec
DL_GF_Imp DL_GF_Imp volatile_blood_explosion 278057 86236 287 1.43 10240 20481 7.3 7.2 17.6% 0.0% 0.0% 0.0% 36.27sec 86236 299.99sec
DL_GF_Imp DL_GF_Imp_imp firebolt 3110 942462 3142 20.61 7776 15545 103.9 103.0 17.6% 0.0% 0.0% 0.0% 2.89sec 942462 299.99sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.19sec 0 64.41sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard felstorm ticks -89751 41965 140 3.89 1829 3658 3.9 19.5 17.8% 0.0% 0.0% 0.0% 80.92sec 59994 64.41sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard legion_strike 30213 119070 1849 17.19 5478 10946 18.5 18.5 17.8% 0.0% 0.0% 0.0% 13.89sec 170224 64.41sec
DL_GF_Imp DL_GF_Imp_grimoire_felguard melee 0 145580 2260 38.16 3020 6039 41.0 41.0 17.7% 0.0% 0.0% 0.0% 6.36sec 208125 64.41sec
DL_GF_Imp DL_GF_Imp_darkhound fel_bite 272435 18856 1886 53.49 1796 3588 8.9 8.9 17.8% 0.0% 0.0% 0.0% 13.10sec 26957 10.00sec
DL_GF_Imp DL_GF_Imp_darkhound melee 0 33379 3339 256.09 665 1330 42.7 42.7 17.7% 0.0% 0.0% 0.0% 2.65sec 47719 10.00sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.75sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath1 272156 19439 1414 30.18 2388 4779 6.9 6.9 17.7% 0.0% 0.0% 0.0% 16.82sec 19439 13.75sec
DL_GF_Imp DL_GF_Imp_void_terror double_breath2 272156 19445 1414 30.18 2389 4771 6.9 6.9 17.7% 0.0% 0.0% 0.0% 16.82sec 19445 13.75sec
DL_GF_Imp DL_GF_Imp_void_terror melee 0 32758 2382 182.79 665 1329 41.9 41.9 17.6% 0.0% 0.0% 0.0% 2.60sec 46832 13.75sec
DL_GF_Imp DL_GF_Imp_vilefiend bile_spit 267997 70974 500 2.86 8929 17863 6.8 6.8 17.4% 0.0% 0.0% 0.0% 47.23sec 164568 142.00sec
DL_GF_Imp DL_GF_Imp_vilefiend bile_spit ticks -267997 93593 312 6.63 2822 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.23sec 164568 142.00sec
DL_GF_Imp DL_GF_Imp_vilefiend headbutt 267999 104118 733 12.05 3106 6212 28.5 28.5 17.6% 0.0% 0.0% 0.0% 10.26sec 148849 142.00sec
DL_GF_Imp DL_GF_Imp_vilefiend melee 0 185061 1303 43.44 1531 3061 102.8 102.8 17.6% 0.0% 0.0% 0.0% 2.81sec 264567 142.00sec
DL_GF_Imp DL_GF_Imp_dreadstalker dreadbite 205196 264165 2435 16.09 7719 15425 29.1 29.1 17.6% 0.0% 0.0% 0.0% 20.93sec 264165 108.47sec
DL_GF_Imp DL_GF_Imp_dreadstalker melee 0 457124 4214 172.71 1244 2488 312.3 312.3 17.7% 0.0% 0.0% 0.0% 1.89sec 653514 108.47sec
DL_GF_Imp DL_GF_Imp_vicious_hellhound demon_fangs 272013 26142 1909 40.68 2393 4784 9.3 9.3 17.7% 0.0% 0.0% 0.0% 12.58sec 26142 13.70sec
DL_GF_Imp DL_GF_Imp_vicious_hellhound melee 0 16114 1177 360.18 167 333 82.2 82.2 17.7% 0.0% 0.0% 0.0% 1.36sec 23037 13.70sec
DL_GF_Imp DL_GF_Imp_wild_imp fel_firebolt 104318 742494 8264 661.38 637 1274 994.5 990.4 17.7% 0.0% 0.0% 0.0% 0.29sec 742494 89.85sec
DL_GF_Imp DL_GF_Imp_demonic_tyrant demonfire 270481 246427 4642 42.57 5560 11125 37.7 37.7 17.7% 0.0% 0.0% 0.0% 6.92sec 246427 53.08sec
DL_GF_Imp DL_GF_Imp_illidari_satyr melee 0 16748 1338 205.00 332 665 42.8 42.8 17.8% 0.0% 0.0% 0.0% 2.77sec 23943 12.52sec
DL_GF_Imp DL_GF_Imp_illidari_satyr melee_oh 0 8369 669 205.00 166 332 42.8 42.8 17.8% 0.0% 0.0% 0.0% 2.77sec 11964 12.52sec
DL_GF_Imp DL_GF_Imp_illidari_satyr shadow_slash 272012 25697 2053 43.75 2395 4791 9.1 9.1 17.6% 0.0% 0.0% 0.0% 13.43sec 25697 12.52sec
DL_GF_Imp DL_GF_Imp_wrathguard melee 0 33032 2086 160.04 665 1329 42.2 42.2 17.7% 0.0% 0.0% 0.0% 2.65sec 47224 15.83sec
DL_GF_Imp DL_GF_Imp_wrathguard melee_oh 0 16555 1046 160.04 332 665 42.2 42.2 18.0% 0.0% 0.0% 0.0% 2.65sec 23668 15.83sec
DL_GF_Imp DL_GF_Imp_wrathguard overhead_assault 272432 18730 1183 33.54 1795 3588 8.8 8.8 17.9% 0.0% 0.0% 0.0% 13.08sec 26776 15.83sec
DL_GF_Imp DL_GF_Imp_bilescourge toxic_bile 272167 156646 13168 279.58 2402 4801 55.4 55.4 17.7% 0.0% 0.0% 0.0% 1.93sec 156646 11.90sec
DL_GF_Imp DL_GF_Imp_urzul many_faced_bite 272439 19894 1918 54.54 1793 3592 9.4 9.4 17.6% 0.0% 0.0% 0.0% 12.12sec 28441 10.37sec
DL_GF_Imp DL_GF_Imp_urzul melee 0 33252 3206 245.76 665 1330 42.5 42.5 17.7% 0.0% 0.0% 0.0% 2.60sec 47537 10.37sec
DL_GF_Imp DL_GF_Imp_shivarra melee 0 33359 2449 187.99 665 1329 42.7 42.7 17.6% 0.0% 0.0% 0.0% 2.63sec 47690 13.62sec
DL_GF_Imp DL_GF_Imp_shivarra melee_oh 0 16704 1227 187.99 332 664 42.7 42.7 17.8% 0.0% 0.0% 0.0% 2.63sec 23880 13.62sec
DL_GF_Imp DL_GF_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.62sec
DL_GF_Imp DL_GF_Imp_shivarra multislash1 272172 6853 503 30.42 844 1686 6.9 6.9 17.7% 0.0% 0.0% 0.0% 17.56sec 9798 13.62sec
DL_GF_Imp DL_GF_Imp_shivarra multislash2 272172 6863 504 30.42 844 1687 6.9 6.9 17.8% 0.0% 0.0% 0.0% 17.56sec 9811 13.62sec
DL_GF_Imp DL_GF_Imp_shivarra multislash3 272172 6874 505 30.42 844 1687 6.9 6.9 18.0% 0.0% 0.0% 0.0% 17.56sec 9828 13.62sec
DL_GF_Imp DL_GF_Imp_shivarra multislash4 272172 6840 502 30.42 844 1688 6.9 6.9 17.4% 0.0% 0.0% 0.0% 17.56sec 9779 13.62sec
DL_GF_Imp DL_GF_Imp_prince_malchezaar melee 0 78922 6961 112.87 3150 6284 21.3 21.3 17.5% 0.0% 0.0% 0.0% 1.47sec 112828 11.34sec
DL_GF_Imp DL_GF_Imp_prince_malchezaar melee_oh 0 39557 3489 112.87 1575 3141 21.3 21.3 17.8% 0.0% 0.0% 0.0% 1.47sec 56552 11.34sec
DL_GF_Imp DL_GF_Imp_eye_of_guldan eye_of_guldan ticks -272131 24090 80 12.04 400 0 27.5 60.2 0.0% 0.0% 0.0% 0.0% 4.44sec 24090 14.48sec
DL_ID_Felguard DL_ID_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.95sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.05sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard demonbolt 264178 400692 1336 9.58 7113 14230 47.1 47.9 17.6% 0.0% 0.0% 0.0% 5.81sec 400692 299.99sec
DL_ID_Felguard DL_ID_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard hand_of_guldan 105174 329633 1099 12.55 4462 8936 62.9 62.8 17.7% 0.0% 0.0% 0.0% 4.73sec 329633 299.99sec
DL_ID_Felguard DL_ID_Felguard heed_my_call 271685 42272 141 1.46 4925 9849 7.3 7.3 17.5% 0.0% 0.0% 0.0% 36.73sec 42272 299.99sec
DL_ID_Felguard DL_ID_Felguard heed_my_call_aoe 271686 18158 61 1.46 2111 4221 7.3 7.3 17.8% 0.0% 0.0% 0.0% 36.73sec 18158 299.99sec
DL_ID_Felguard DL_ID_Felguard inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard shadow_bolt 686 394484 1315 18.66 3593 7188 93.9 93.3 17.7% 0.0% 0.0% 0.0% 3.14sec 394484 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.56sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.64sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.19sec 0 299.99sec
DL_ID_Felguard DL_ID_Felguard volatile_blood_explosion 278057 87157 291 1.45 10240 20481 7.3 7.2 17.7% 0.0% 0.0% 0.0% 36.60sec 87157 299.99sec
DL_ID_Felguard DL_ID_Felguard_felguard felstorm ticks -89751 113675 379 12.42 1556 3112 10.4 62.1 17.6% 0.0% 0.0% 0.0% 30.14sec 162511 299.99sec
DL_ID_Felguard DL_ID_Felguard_felguard legion_strike 30213 317300 1058 11.68 4626 9251 58.4 58.4 17.5% 0.0% 0.0% 0.0% 5.10sec 453619 299.99sec
DL_ID_Felguard DL_ID_Felguard_felguard melee 0 516023 1720 34.72 2527 5055 173.6 173.6 17.6% 0.0% 0.0% 0.0% 1.71sec 737717 299.99sec
DL_ID_Felguard DL_ID_Felguard_urzul many_faced_bite 272439 21982 1916 55.16 1778 3549 10.5 10.5 17.3% 0.0% 0.0% 0.0% 12.75sec 31426 11.47sec
DL_ID_Felguard DL_ID_Felguard_urzul melee 0 36386 3171 245.34 659 1319 46.9 46.9 17.6% 0.0% 0.0% 0.0% 2.80sec 52018 11.47sec
DL_ID_Felguard DL_ID_Felguard_darkhound fel_bite 272435 20822 1726 49.47 1779 3558 9.9 9.9 17.6% 0.0% 0.0% 0.0% 13.68sec 29768 12.07sec
DL_ID_Felguard DL_ID_Felguard_darkhound melee 0 36489 3024 233.96 660 1319 47.0 47.0 17.6% 0.0% 0.0% 0.0% 2.81sec 52165 12.07sec
DL_ID_Felguard DL_ID_Felguard_vilefiend bile_spit 267997 70893 473 2.73 8824 17653 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.19sec 163747 149.85sec
DL_ID_Felguard DL_ID_Felguard_vilefiend bile_spit ticks -267997 92854 310 6.69 2777 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.19sec 163747 149.85sec
DL_ID_Felguard DL_ID_Felguard_vilefiend headbutt 267999 109743 732 12.05 3100 6197 30.1 30.1 17.7% 0.0% 0.0% 0.0% 9.84sec 156891 149.85sec
DL_ID_Felguard DL_ID_Felguard_vilefiend melee 0 193557 1292 43.17 1526 3052 107.8 107.8 17.7% 0.0% 0.0% 0.0% 2.72sec 276713 149.85sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 14.16sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath1 272156 21715 1534 33.04 2367 4732 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.09sec 21715 14.16sec
DL_ID_Felguard DL_ID_Felguard_void_terror double_breath2 272156 21712 1534 33.04 2367 4736 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.09sec 21712 14.16sec
DL_ID_Felguard DL_ID_Felguard_void_terror melee 0 36341 2567 198.40 660 1320 46.8 46.8 17.7% 0.0% 0.0% 0.0% 2.69sec 51954 14.16sec
DL_ID_Felguard DL_ID_Felguard_dreadstalker dreadbite 205196 263787 2463 16.27 7720 15434 29.0 29.0 17.6% 0.0% 0.0% 0.0% 21.05sec 263787 107.10sec
DL_ID_Felguard DL_ID_Felguard_dreadstalker melee 0 455657 4255 174.51 1243 2485 311.5 311.5 17.7% 0.0% 0.0% 0.0% 1.90sec 651416 107.10sec
DL_ID_Felguard DL_ID_Felguard_wild_imp fel_firebolt 104318 912198 8975 715.60 640 1279 1217.1 1212.1 17.7% 0.0% 0.0% 0.0% 0.24sec 912198 101.63sec
DL_ID_Felguard DL_ID_Felguard_demonic_tyrant demonfire 270481 246276 4658 42.64 5561 11123 37.7 37.6 17.9% 0.0% 0.0% 0.0% 6.90sec 246276 52.87sec
DL_ID_Felguard DL_ID_Felguard_shivarra melee 0 36586 2925 226.21 659 1319 47.2 47.2 17.6% 0.0% 0.0% 0.0% 2.80sec 52303 12.51sec
DL_ID_Felguard DL_ID_Felguard_shivarra melee_oh 0 18303 1463 226.21 330 659 47.2 47.2 17.7% 0.0% 0.0% 0.0% 2.80sec 26167 12.51sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.51sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash1 272172 7576 606 37.03 836 1668 7.7 7.7 17.5% 0.0% 0.0% 0.0% 18.21sec 10831 12.51sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash2 272172 7577 606 37.03 835 1671 7.7 7.7 17.5% 0.0% 0.0% 0.0% 18.21sec 10832 12.51sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash3 272172 7604 608 37.03 835 1670 7.7 7.7 17.9% 0.0% 0.0% 0.0% 18.21sec 10871 12.51sec
DL_ID_Felguard DL_ID_Felguard_shivarra multislash4 272172 7586 607 37.03 835 1671 7.7 7.7 17.6% 0.0% 0.0% 0.0% 18.21sec 10845 12.51sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr melee 0 18475 1278 197.76 330 659 47.7 47.7 17.6% 0.0% 0.0% 0.0% 2.81sec 26413 14.46sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr melee_oh 0 9241 639 197.76 165 330 47.7 47.7 17.6% 0.0% 0.0% 0.0% 2.81sec 13211 14.46sec
DL_ID_Felguard DL_ID_Felguard_illidari_satyr shadow_slash 272012 28877 1997 42.86 2375 4745 10.3 10.3 17.7% 0.0% 0.0% 0.0% 13.25sec 28877 14.46sec
DL_ID_Felguard DL_ID_Felguard_bilescourge toxic_bile 272167 172268 13004 278.33 2384 4769 61.5 61.5 17.6% 0.0% 0.0% 0.0% 2.09sec 172268 13.25sec
DL_ID_Felguard DL_ID_Felguard_wrathguard melee 0 36284 2454 189.53 659 1319 46.7 46.7 17.8% 0.0% 0.0% 0.0% 2.76sec 51872 14.78sec
DL_ID_Felguard DL_ID_Felguard_wrathguard melee_oh 0 18110 1225 189.53 330 660 46.7 46.7 17.6% 0.0% 0.0% 0.0% 2.76sec 25890 14.78sec
DL_ID_Felguard DL_ID_Felguard_wrathguard overhead_assault 272432 20690 1400 40.12 1780 3554 9.9 9.9 17.7% 0.0% 0.0% 0.0% 13.37sec 29579 14.78sec
DL_ID_Felguard DL_ID_Felguard_prince_malchezaar melee 0 77704 4669 75.96 3125 6253 21.1 21.1 18.0% 0.0% 0.0% 0.0% 1.60sec 111087 16.64sec
DL_ID_Felguard DL_ID_Felguard_prince_malchezaar melee_oh 0 38856 2335 75.96 1563 3122 21.1 21.1 18.0% 0.0% 0.0% 0.0% 1.60sec 55550 16.64sec
DL_ID_Felguard DL_ID_Felguard_vicious_hellhound demon_fangs 272013 29378 2333 50.15 2373 4748 10.5 10.5 17.6% 0.0% 0.0% 0.0% 12.70sec 29378 12.59sec
DL_ID_Felguard DL_ID_Felguard_vicious_hellhound melee 0 17887 1420 438.08 165 331 92.0 92.0 17.7% 0.0% 0.0% 0.0% 1.41sec 25572 12.59sec
DL_ID_Felguard DL_ID_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24217 81 12.15 399 0 28.1 60.7 0.0% 0.0% 0.0% 0.0% 4.83sec 24217 8.06sec
DL_ID_Imp DL_ID_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.99sec 0 299.99sec
DL_ID_Imp DL_ID_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.05sec 0 299.99sec
DL_ID_Imp DL_ID_Imp demonbolt 264178 399325 1331 9.54 7115 14232 46.9 47.7 17.6% 0.0% 0.0% 0.0% 5.83sec 399325 299.99sec
DL_ID_Imp DL_ID_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp hand_of_guldan 105174 329159 1097 12.54 4464 8923 62.8 62.7 17.6% 0.0% 0.0% 0.0% 4.73sec 329159 299.99sec
DL_ID_Imp DL_ID_Imp heed_my_call 271685 42051 140 1.46 4925 9849 7.3 7.3 17.3% 0.0% 0.0% 0.0% 37.12sec 42051 299.99sec
DL_ID_Imp DL_ID_Imp heed_my_call_aoe 271686 18096 60 1.46 2111 4221 7.3 7.3 17.7% 0.0% 0.0% 0.0% 37.12sec 18096 299.99sec
DL_ID_Imp DL_ID_Imp inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp shadow_bolt 686 394887 1316 18.68 3593 7186 94.1 93.4 17.7% 0.0% 0.0% 0.0% 3.13sec 394887 299.99sec
DL_ID_Imp DL_ID_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.54sec 0 299.99sec
DL_ID_Imp DL_ID_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DL_ID_Imp DL_ID_Imp summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.73sec 0 299.99sec
DL_ID_Imp DL_ID_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.19sec 0 299.99sec
DL_ID_Imp DL_ID_Imp volatile_blood_explosion 278057 86256 288 1.43 10240 20481 7.3 7.2 17.5% 0.0% 0.0% 0.0% 37.24sec 86256 299.99sec
DL_ID_Imp DL_ID_Imp_imp firebolt 3110 940114 3134 20.59 7759 15521 103.8 103.0 17.7% 0.0% 0.0% 0.0% 2.89sec 940114 299.99sec
DL_ID_Imp DL_ID_Imp_vicious_hellhound demon_fangs 272013 29147 2636 56.74 2372 4746 10.5 10.5 17.5% 0.0% 0.0% 0.0% 12.80sec 29147 11.06sec
DL_ID_Imp DL_ID_Imp_vicious_hellhound melee 0 17779 1608 496.35 165 331 91.5 91.5 17.6% 0.0% 0.0% 0.0% 1.41sec 25418 11.06sec
DL_ID_Imp DL_ID_Imp_urzul many_faced_bite 272439 21904 1507 43.20 1778 3554 10.5 10.5 17.8% 0.0% 0.0% 0.0% 12.44sec 31314 14.53sec
DL_ID_Imp DL_ID_Imp_urzul melee 0 36133 2486 192.28 659 1319 46.6 46.6 17.6% 0.0% 0.0% 0.0% 2.76sec 51656 14.53sec
DL_ID_Imp DL_ID_Imp_vilefiend bile_spit 267997 71160 475 2.73 8824 17650 6.8 6.8 18.1% 0.0% 0.0% 0.0% 47.19sec 163983 149.79sec
DL_ID_Imp DL_ID_Imp_vilefiend bile_spit ticks -267997 92823 309 6.68 2777 0 6.8 33.4 0.0% 0.0% 0.0% 0.0% 47.19sec 163983 149.79sec
DL_ID_Imp DL_ID_Imp_vilefiend headbutt 267999 109671 732 12.05 3100 6198 30.1 30.1 17.6% 0.0% 0.0% 0.0% 9.82sec 156789 149.79sec
DL_ID_Imp DL_ID_Imp_vilefiend melee 0 193405 1291 43.17 1526 3051 107.8 107.8 17.6% 0.0% 0.0% 0.0% 2.71sec 276495 149.79sec
DL_ID_Imp DL_ID_Imp_dreadstalker dreadbite 205196 263999 2440 16.11 7718 15441 29.0 29.0 17.7% 0.0% 0.0% 0.0% 21.05sec 263999 108.18sec
DL_ID_Imp DL_ID_Imp_dreadstalker melee 0 456104 4216 172.99 1243 2485 311.9 311.9 17.7% 0.0% 0.0% 0.0% 1.90sec 652056 108.18sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 9.12sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath1 272156 21968 2410 51.81 2366 4737 7.9 7.9 17.9% 0.0% 0.0% 0.0% 17.23sec 21968 9.12sec
DL_ID_Imp DL_ID_Imp_void_terror double_breath2 272156 21903 2402 51.81 2365 4740 7.9 7.9 17.5% 0.0% 0.0% 0.0% 17.23sec 21903 9.12sec
DL_ID_Imp DL_ID_Imp_void_terror melee 0 36665 4021 310.79 660 1319 47.2 47.2 17.7% 0.0% 0.0% 0.0% 2.72sec 52416 9.12sec
DL_ID_Imp DL_ID_Imp_wild_imp fel_firebolt 104318 911676 10021 798.81 640 1279 1216.1 1211.2 17.7% 0.0% 0.0% 0.0% 0.24sec 911676 90.98sec
DL_ID_Imp DL_ID_Imp_bilescourge toxic_bile 272167 169600 10890 232.97 2382 4764 60.5 60.5 17.7% 0.0% 0.0% 0.0% 2.06sec 169600 15.57sec
DL_ID_Imp DL_ID_Imp_demonic_tyrant demonfire 270481 246087 4653 42.65 5561 11127 37.7 37.6 17.7% 0.0% 0.0% 0.0% 6.88sec 246087 52.88sec
DL_ID_Imp DL_ID_Imp_shivarra melee 0 36725 2769 214.35 659 1319 47.4 47.4 17.6% 0.0% 0.0% 0.0% 2.83sec 52503 13.26sec
DL_ID_Imp DL_ID_Imp_shivarra melee_oh 0 18365 1385 214.35 330 660 47.4 47.4 17.6% 0.0% 0.0% 0.0% 2.83sec 26255 13.26sec
DL_ID_Imp DL_ID_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.26sec
DL_ID_Imp DL_ID_Imp_shivarra multislash1 272172 7636 576 35.10 835 1670 7.8 7.8 17.8% 0.0% 0.0% 0.0% 18.39sec 10916 13.26sec
DL_ID_Imp DL_ID_Imp_shivarra multislash2 272172 7606 574 35.10 835 1672 7.8 7.8 17.4% 0.0% 0.0% 0.0% 18.39sec 10874 13.26sec
DL_ID_Imp DL_ID_Imp_shivarra multislash3 272172 7644 576 35.10 836 1669 7.8 7.8 18.0% 0.0% 0.0% 0.0% 18.39sec 10927 13.26sec
DL_ID_Imp DL_ID_Imp_shivarra multislash4 272172 7641 576 35.10 835 1671 7.8 7.8 17.9% 0.0% 0.0% 0.0% 18.39sec 10924 13.26sec
DL_ID_Imp DL_ID_Imp_illidari_satyr melee 0 18242 1329 205.86 330 659 47.1 47.1 17.6% 0.0% 0.0% 0.0% 2.72sec 26079 13.72sec
DL_ID_Imp DL_ID_Imp_illidari_satyr melee_oh 0 9130 665 205.86 165 330 47.1 47.1 17.7% 0.0% 0.0% 0.0% 2.72sec 13053 13.72sec
DL_ID_Imp DL_ID_Imp_illidari_satyr shadow_slash 272012 28481 2075 44.60 2373 4746 10.2 10.2 17.6% 0.0% 0.0% 0.0% 12.81sec 28481 13.72sec
DL_ID_Imp DL_ID_Imp_darkhound fel_bite 272435 20864 1550 44.56 1779 3559 10.0 10.0 17.3% 0.0% 0.0% 0.0% 13.24sec 29828 13.46sec
DL_ID_Imp DL_ID_Imp_darkhound melee 0 36708 2728 210.84 659 1320 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.72sec 52479 13.46sec
DL_ID_Imp DL_ID_Imp_wrathguard melee 0 37019 2718 210.13 659 1320 47.7 47.7 17.7% 0.0% 0.0% 0.0% 2.70sec 52923 13.62sec
DL_ID_Imp DL_ID_Imp_wrathguard melee_oh 0 18502 1359 210.13 330 660 47.7 47.7 17.6% 0.0% 0.0% 0.0% 2.70sec 26450 13.62sec
DL_ID_Imp DL_ID_Imp_wrathguard overhead_assault 272432 21134 1552 44.50 1779 3556 10.1 10.1 17.7% 0.0% 0.0% 0.0% 13.03sec 30214 13.62sec
DL_ID_Imp DL_ID_Imp_prince_malchezaar melee 0 78794 4036 65.80 3122 6244 21.4 21.4 17.9% 0.0% 0.0% 0.0% 1.50sec 112645 19.52sec
DL_ID_Imp DL_ID_Imp_prince_malchezaar melee_oh 0 39246 2010 65.80 1561 3121 21.4 21.4 17.4% 0.0% 0.0% 0.0% 1.50sec 56107 19.52sec
DL_ID_Imp DL_ID_Imp_eye_of_guldan eye_of_guldan ticks -272131 24615 82 12.33 399 0 28.5 61.7 0.0% 0.0% 0.0% 0.0% 4.87sec 24615 13.95sec
DStr_GF_Felguard DStr_GF_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.55sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 20.96sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard demonbolt 264178 370740 1236 8.88 7099 14201 43.5 44.4 17.7% 0.0% 0.0% 0.0% 6.29sec 370740 299.99sec
DStr_GF_Felguard DStr_GF_Felguard demonic_strength 267171 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.47sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.75sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard hand_of_guldan 105174 307684 1026 11.83 4419 8832 59.3 59.2 17.7% 0.0% 0.0% 0.0% 4.97sec 307684 299.99sec
DStr_GF_Felguard DStr_GF_Felguard heed_my_call 271685 42436 141 1.47 4925 9849 7.3 7.3 17.6% 0.0% 0.0% 0.0% 37.00sec 42436 299.99sec
DStr_GF_Felguard DStr_GF_Felguard heed_my_call_aoe 271686 18241 61 1.47 2111 4221 7.3 7.3 17.9% 0.0% 0.0% 0.0% 37.00sec 18241 299.99sec
DStr_GF_Felguard DStr_GF_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.60sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard shadow_bolt 686 390407 1301 18.47 3592 7185 93.0 92.3 17.7% 0.0% 0.0% 0.0% 3.14sec 390407 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.66sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_random_demon 0 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 13.86sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.7 0.0 0.0% 0.0% 0.0% 0.0% 47.34sec 0 299.99sec
DStr_GF_Felguard DStr_GF_Felguard volatile_blood_explosion 278057 86766 289 1.44 10240 20481 7.3 7.2 17.5% 0.0% 0.0% 0.0% 36.73sec 86766 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard demonic_strength_felstorm ticks -89751 238052 794 6.47 6241 12484 5.4 32.4 17.8% 0.0% 0.0% 0.0% 60.70sec 340324 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard felstorm ticks -89751 110342 368 12.12 1546 3092 10.2 60.6 17.7% 0.0% 0.0% 0.0% 30.59sec 157747 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard legion_strike 30213 290749 969 10.65 4648 9299 53.2 53.2 17.5% 0.0% 0.0% 0.0% 5.53sec 415661 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_felguard melee 0 480421 1601 32.23 2534 5068 161.1 161.1 17.7% 0.0% 0.0% 0.0% 1.82sec 686819 299.99sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.08sec 0 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard felstorm ticks -89751 41895 140 3.88 1832 3662 3.9 19.4 17.7% 0.0% 0.0% 0.0% 80.69sec 59894 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard legion_strike 30213 118670 1847 17.22 5472 10935 18.4 18.4 17.6% 0.0% 0.0% 0.0% 13.86sec 169653 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_grimoire_felguard melee 0 145522 2264 38.25 3018 6032 41.0 41.0 17.7% 0.0% 0.0% 0.0% 6.32sec 208041 64.26sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr melee 0 16734 1233 189.54 332 664 42.9 42.9 17.6% 0.0% 0.0% 0.0% 2.63sec 23924 13.57sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr melee_oh 0 8372 617 189.54 166 332 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.63sec 11968 13.57sec
DStr_GF_Felguard DStr_GF_Felguard_illidari_satyr shadow_slash 272012 25642 1889 40.34 2394 4790 9.1 9.1 17.4% 0.0% 0.0% 0.0% 12.79sec 25642 13.57sec
DStr_GF_Felguard DStr_GF_Felguard_urzul many_faced_bite 272439 19994 1814 51.45 1792 3585 9.4 9.4 18.1% 0.0% 0.0% 0.0% 12.14sec 28584 11.02sec
DStr_GF_Felguard DStr_GF_Felguard_urzul melee 0 33387 3030 232.51 664 1328 42.7 42.7 17.8% 0.0% 0.0% 0.0% 2.61sec 47731 11.02sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend bile_spit 267997 70516 493 2.82 8905 17799 6.7 6.7 17.6% 0.0% 0.0% 0.0% 47.34sec 163435 143.00sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend bile_spit ticks -267997 92919 310 6.59 2820 0 6.7 33.0 0.0% 0.0% 0.0% 0.0% 47.34sec 163435 143.00sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend headbutt 267999 104961 734 12.05 3107 6215 28.7 28.7 17.7% 0.0% 0.0% 0.0% 10.14sec 150055 143.00sec
DStr_GF_Felguard DStr_GF_Felguard_vilefiend melee 0 186207 1302 43.42 1529 3058 103.5 103.5 17.7% 0.0% 0.0% 0.0% 2.79sec 266205 143.00sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra melee 0 33511 2543 195.27 664 1327 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.70sec 47908 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra melee_oh 0 16729 1270 195.27 332 664 42.9 42.9 17.5% 0.0% 0.0% 0.0% 2.70sec 23916 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash1 272172 6869 521 31.49 843 1684 6.9 6.9 17.8% 0.0% 0.0% 0.0% 18.10sec 9820 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash2 272172 6874 522 31.49 843 1686 6.9 6.9 17.9% 0.0% 0.0% 0.0% 18.10sec 9827 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash3 272172 6873 522 31.49 843 1687 6.9 6.9 17.9% 0.0% 0.0% 0.0% 18.10sec 9825 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_shivarra multislash4 272172 6851 520 31.49 843 1686 6.9 6.9 17.5% 0.0% 0.0% 0.0% 18.10sec 9795 13.18sec
DStr_GF_Felguard DStr_GF_Felguard_dreadstalker dreadbite 205196 210431 1946 16.08 6173 12344 29.0 29.0 17.6% 0.0% 0.0% 0.0% 20.96sec 210431 108.13sec
DStr_GF_Felguard DStr_GF_Felguard_dreadstalker melee 0 456761 4224 173.25 1244 2487 312.2 312.2 17.6% 0.0% 0.0% 0.0% 1.88sec 652995 108.13sec
DStr_GF_Felguard DStr_GF_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24620 82 12.31 400 0 28.2 61.5 0.0% 0.0% 0.0% 0.0% 5.32sec 24620 15.87sec
DStr_GF_Felguard DStr_GF_Felguard_wild_imp fel_firebolt 104318 730201 8210 656.98 637 1274 977.9 973.9 17.7% 0.0% 0.0% 0.0% 0.30sec 730201 88.94sec
DStr_GF_Felguard DStr_GF_Felguard_demonic_tyrant demonfire 270481 245699 4644 42.63 5562 11122 37.7 37.6 17.5% 0.0% 0.0% 0.0% 6.92sec 245699 52.91sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 17.66sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath1 272156 19812 1122 24.01 2386 4773 7.1 7.1 17.5% 0.0% 0.0% 0.0% 17.64sec 19812 17.66sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror double_breath2 272156 19919 1128 24.01 2385 4779 7.1 7.1 18.1% 0.0% 0.0% 0.0% 17.64sec 19919 17.66sec
DStr_GF_Felguard DStr_GF_Felguard_void_terror melee 0 33694 1908 146.43 664 1328 43.1 43.1 17.8% 0.0% 0.0% 0.0% 2.68sec 48170 17.66sec
DStr_GF_Felguard DStr_GF_Felguard_bilescourge toxic_bile 272167 154711 20518 435.71 2397 4796 54.8 54.8 17.8% 0.0% 0.0% 0.0% 2.04sec 154711 7.54sec
DStr_GF_Felguard DStr_GF_Felguard_darkhound fel_bite 272435 18696 1701 48.30 1793 3590 8.8 8.8 17.8% 0.0% 0.0% 0.0% 12.97sec 26728 10.99sec
DStr_GF_Felguard DStr_GF_Felguard_darkhound melee 0 33212 3022 232.14 664 1328 42.5 42.5 17.6% 0.0% 0.0% 0.0% 2.59sec 47481 10.99sec
DStr_GF_Felguard DStr_GF_Felguard_vicious_hellhound demon_fangs 272013 26334 3000 64.06 2391 4788 9.4 9.4 17.5% 0.0% 0.0% 0.0% 12.49sec 26334 8.78sec
DStr_GF_Felguard DStr_GF_Felguard_vicious_hellhound melee 0 16350 1863 570.97 166 333 83.5 83.5 17.7% 0.0% 0.0% 0.0% 1.35sec 23374 8.78sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard melee 0 33312 3089 237.36 664 1327 42.7 42.7 17.6% 0.0% 0.0% 0.0% 2.66sec 47623 10.78sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard melee_oh 0 16667 1546 237.36 332 664 42.7 42.7 17.7% 0.0% 0.0% 0.0% 2.66sec 23828 10.78sec
DStr_GF_Felguard DStr_GF_Felguard_wrathguard overhead_assault 272432 18642 1729 49.23 1795 3591 8.8 8.8 17.4% 0.0% 0.0% 0.0% 13.29sec 26652 10.78sec
DStr_GF_Felguard DStr_GF_Felguard_prince_malchezaar melee 0 77077 4167 67.75 3144 6278 20.9 20.9 17.4% 0.0% 0.0% 0.0% 1.39sec 110191 18.50sec
DStr_GF_Felguard DStr_GF_Felguard_prince_malchezaar melee_oh 0 38470 2080 67.75 1572 3136 20.9 20.9 17.2% 0.0% 0.0% 0.0% 1.39sec 54998 18.50sec
DStr_GF_Imp DStr_GF_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 187.29sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 20.94sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp demonbolt 264178 375438 1252 8.98 7110 14223 44.1 44.9 17.5% 0.0% 0.0% 0.0% 6.22sec 375438 299.99sec
DStr_GF_Imp DStr_GF_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp grimoire_felguard 111898 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp hand_of_guldan 105174 315310 1051 12.06 4446 8903 60.4 60.3 17.6% 0.0% 0.0% 0.0% 4.90sec 315310 299.99sec
DStr_GF_Imp DStr_GF_Imp heed_my_call 271685 42329 141 1.46 4925 9849 7.3 7.3 17.7% 0.0% 0.0% 0.0% 37.13sec 42329 299.99sec
DStr_GF_Imp DStr_GF_Imp heed_my_call_aoe 271686 18170 61 1.46 2111 4221 7.3 7.3 17.9% 0.0% 0.0% 0.0% 37.13sec 18170 299.99sec
DStr_GF_Imp DStr_GF_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp shadow_bolt 686 402319 1341 19.03 3595 7189 95.8 95.1 17.7% 0.0% 0.0% 0.0% 3.05sec 402319 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.50sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_random_demon 0 0 0 0.00 0 0 15.1 0.0 0.0% 0.0% 0.0% 0.0% 14.67sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.24sec 0 299.99sec
DStr_GF_Imp DStr_GF_Imp volatile_blood_explosion 278057 87041 290 1.44 10240 20481 7.3 7.2 18.0% 0.0% 0.0% 0.0% 37.25sec 87041 299.99sec
DStr_GF_Imp DStr_GF_Imp_imp firebolt 3110 943025 3144 20.61 7775 15550 103.9 103.0 17.7% 0.0% 0.0% 0.0% 2.89sec 943025 299.99sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard axe_toss 89766 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 80.24sec 0 64.40sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard felstorm ticks -89751 41938 140 3.89 1830 3660 3.9 19.5 17.7% 0.0% 0.0% 0.0% 80.63sec 59955 64.40sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard legion_strike 30213 119140 1850 17.19 5477 10969 18.5 18.5 17.8% 0.0% 0.0% 0.0% 13.89sec 170325 64.40sec
DStr_GF_Imp DStr_GF_Imp_grimoire_felguard melee 0 145639 2261 38.17 3021 6040 41.0 41.0 17.7% 0.0% 0.0% 0.0% 6.36sec 208209 64.40sec
DStr_GF_Imp DStr_GF_Imp_vicious_hellhound demon_fangs 272013 26302 2258 48.14 2393 4780 9.3 9.3 17.7% 0.0% 0.0% 0.0% 12.46sec 26302 11.65sec
DStr_GF_Imp DStr_GF_Imp_vicious_hellhound melee 0 16229 1393 427.02 167 333 82.9 82.9 17.6% 0.0% 0.0% 0.0% 1.35sec 23201 11.65sec
DStr_GF_Imp DStr_GF_Imp_darkhound fel_bite 272435 18924 1369 38.98 1795 3590 9.0 9.0 17.4% 0.0% 0.0% 0.0% 13.18sec 27054 13.82sec
DStr_GF_Imp DStr_GF_Imp_darkhound melee 0 33511 2424 185.96 665 1330 42.8 42.8 17.7% 0.0% 0.0% 0.0% 2.66sec 47909 13.82sec
DStr_GF_Imp DStr_GF_Imp_vilefiend bile_spit 267997 70917 499 2.86 8928 17849 6.8 6.8 17.3% 0.0% 0.0% 0.0% 47.24sec 164485 142.04sec
DStr_GF_Imp DStr_GF_Imp_vilefiend bile_spit ticks -267997 93568 312 6.63 2822 0 6.8 33.2 0.0% 0.0% 0.0% 0.0% 47.24sec 164485 142.04sec
DStr_GF_Imp DStr_GF_Imp_vilefiend headbutt 267999 104156 733 12.05 3105 6214 28.5 28.5 17.6% 0.0% 0.0% 0.0% 10.27sec 148903 142.04sec
DStr_GF_Imp DStr_GF_Imp_vilefiend melee 0 185209 1304 43.45 1530 3063 102.9 102.9 17.6% 0.0% 0.0% 0.0% 2.82sec 264778 142.04sec
DStr_GF_Imp DStr_GF_Imp_dreadstalker dreadbite 205196 211673 1952 16.10 6173 12358 29.1 29.1 17.8% 0.0% 0.0% 0.0% 20.94sec 211673 108.45sec
DStr_GF_Imp DStr_GF_Imp_dreadstalker melee 0 457244 4216 172.82 1244 2488 312.4 312.4 17.7% 0.0% 0.0% 0.0% 1.89sec 653686 108.45sec
DStr_GF_Imp DStr_GF_Imp_shivarra melee 0 33588 2445 187.41 665 1330 42.9 42.9 17.8% 0.0% 0.0% 0.0% 2.63sec 48018 13.74sec
DStr_GF_Imp DStr_GF_Imp_shivarra melee_oh 0 16781 1222 187.41 332 665 42.9 42.9 17.7% 0.0% 0.0% 0.0% 2.63sec 23990 13.74sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 13.74sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash1 272172 6885 501 30.29 844 1687 6.9 6.9 17.7% 0.0% 0.0% 0.0% 17.57sec 9843 13.74sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash2 272172 6874 500 30.29 844 1688 6.9 6.9 17.5% 0.0% 0.0% 0.0% 17.57sec 9827 13.74sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash3 272172 6898 502 30.29 844 1687 6.9 6.9 17.9% 0.0% 0.0% 0.0% 17.57sec 9862 13.74sec
DStr_GF_Imp DStr_GF_Imp_shivarra multislash4 272172 6898 502 30.29 844 1690 6.9 6.9 17.8% 0.0% 0.0% 0.0% 17.57sec 9861 13.74sec
DStr_GF_Imp DStr_GF_Imp_wild_imp fel_firebolt 104318 742359 8914 713.53 637 1274 994.5 990.3 17.7% 0.0% 0.0% 0.0% 0.29sec 742359 83.28sec
DStr_GF_Imp DStr_GF_Imp_demonic_tyrant demonfire 270481 246760 4649 42.60 5561 11124 37.8 37.7 17.7% 0.0% 0.0% 0.0% 6.90sec 246760 53.08sec
DStr_GF_Imp DStr_GF_Imp_wrathguard melee 0 33006 2766 211.96 665 1329 42.2 42.2 17.7% 0.0% 0.0% 0.0% 2.58sec 47186 11.93sec
DStr_GF_Imp DStr_GF_Imp_wrathguard melee_oh 0 16491 1382 211.96 332 665 42.2 42.2 17.7% 0.0% 0.0% 0.0% 2.58sec 23577 11.93sec
DStr_GF_Imp DStr_GF_Imp_wrathguard overhead_assault 272432 18560 1555 44.20 1795 3590 8.8 8.8 17.6% 0.0% 0.0% 0.0% 12.75sec 26534 11.93sec
DStr_GF_Imp DStr_GF_Imp_bilescourge toxic_bile 272167 155540 10180 216.18 2401 4805 55.1 55.1 17.6% 0.0% 0.0% 0.0% 2.00sec 155540 15.28sec
DStr_GF_Imp DStr_GF_Imp_urzul many_faced_bite 272439 20044 1364 38.71 1792 3590 9.5 9.5 17.9% 0.0% 0.0% 0.0% 12.10sec 28655 14.69sec
DStr_GF_Imp DStr_GF_Imp_urzul melee 0 33410 2274 174.28 665 1331 42.7 42.7 17.7% 0.0% 0.0% 0.0% 2.62sec 47764 14.69sec
DStr_GF_Imp DStr_GF_Imp_prince_malchezaar melee 0 77925 4535 73.20 3151 6310 21.0 21.0 17.9% 0.0% 0.0% 0.0% 1.50sec 111403 17.18sec
DStr_GF_Imp DStr_GF_Imp_prince_malchezaar melee_oh 0 38799 2258 73.20 1576 3148 21.0 21.0 17.5% 0.0% 0.0% 0.0% 1.50sec 55468 17.18sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr melee 0 16684 1310 200.87 332 665 42.6 42.6 17.7% 0.0% 0.0% 0.0% 2.63sec 23851 12.74sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr melee_oh 0 8336 654 200.87 166 332 42.6 42.6 17.6% 0.0% 0.0% 0.0% 2.63sec 11918 12.74sec
DStr_GF_Imp DStr_GF_Imp_illidari_satyr shadow_slash 272012 25628 2012 42.91 2395 4790 9.1 9.1 17.5% 0.0% 0.0% 0.0% 12.70sec 25628 12.74sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 11.09sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath1 272156 19576 1764 37.67 2390 4772 7.0 7.0 17.6% 0.0% 0.0% 0.0% 17.22sec 19576 11.09sec
DStr_GF_Imp DStr_GF_Imp_void_terror double_breath2 272156 19634 1770 37.67 2390 4776 7.0 7.0 18.0% 0.0% 0.0% 0.0% 17.22sec 19634 11.09sec
DStr_GF_Imp DStr_GF_Imp_void_terror melee 0 33197 2992 229.33 665 1330 42.4 42.4 17.7% 0.0% 0.0% 0.0% 2.65sec 47459 11.09sec
DStr_GF_Imp DStr_GF_Imp_eye_of_guldan eye_of_guldan ticks -272131 24101 80 12.04 400 0 27.7 60.2 0.0% 0.0% 0.0% 0.0% 4.17sec 24101 16.52sec
DStr_ID_Felguard DStr_ID_Felguard augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.87sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard call_dreadstalkers 104316 0 0 0.00 0 0 14.5 0.0 0.0% 0.0% 0.0% 0.0% 21.07sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard demonbolt 264178 395263 1318 9.45 7110 14216 46.4 47.2 17.7% 0.0% 0.0% 0.0% 5.89sec 395263 299.99sec
DStr_ID_Felguard DStr_ID_Felguard demonic_strength 267171 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.47sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard hand_of_guldan 105174 321711 1072 12.32 4439 8863 61.7 61.6 17.7% 0.0% 0.0% 0.0% 4.79sec 321711 299.99sec
DStr_ID_Felguard DStr_ID_Felguard heed_my_call 271685 41937 140 1.45 4925 9849 7.3 7.3 17.2% 0.0% 0.0% 0.0% 36.84sec 41937 299.99sec
DStr_ID_Felguard DStr_ID_Felguard heed_my_call_aoe 271686 18096 60 1.45 2111 4221 7.3 7.3 18.0% 0.0% 0.0% 0.0% 36.84sec 18096 299.99sec
DStr_ID_Felguard DStr_ID_Felguard inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.55sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard shadow_bolt 686 382628 1275 18.12 3590 7180 91.2 90.6 17.7% 0.0% 0.0% 0.0% 3.21sec 382628 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.52sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_felguard 30146 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_random_demon 0 0 0 0.00 0 0 17.9 0.0 0.0% 0.0% 0.0% 0.0% 13.74sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.18sec 0 299.99sec
DStr_ID_Felguard DStr_ID_Felguard volatile_blood_explosion 278057 87268 291 1.45 10240 20481 7.3 7.2 17.9% 0.0% 0.0% 0.0% 36.48sec 87268 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard demonic_strength_felstorm ticks -89751 238321 794 6.47 6259 12522 5.4 32.4 17.6% 0.0% 0.0% 0.0% 60.69sec 340708 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard felstorm ticks -89751 110226 367 12.13 1545 3090 10.2 60.6 17.7% 0.0% 0.0% 0.0% 30.58sec 157582 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard legion_strike 30213 289994 967 10.65 4634 9266 53.2 53.2 17.6% 0.0% 0.0% 0.0% 5.52sec 414581 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_felguard melee 0 480404 1601 32.24 2533 5064 161.2 161.2 17.7% 0.0% 0.0% 0.0% 1.82sec 686796 299.99sec
DStr_ID_Felguard DStr_ID_Felguard_urzul many_faced_bite 272439 22016 1570 44.99 1777 3550 10.5 10.5 17.8% 0.0% 0.0% 0.0% 12.33sec 31474 14.03sec
DStr_ID_Felguard DStr_ID_Felguard_urzul melee 0 36458 2599 201.24 659 1318 47.0 47.0 17.6% 0.0% 0.0% 0.0% 2.69sec 52121 14.03sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath1 272156 21813 1358 29.28 2365 4734 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.68sec 21813 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror double_breath2 272156 21754 1354 29.28 2365 4729 7.8 7.8 17.3% 0.0% 0.0% 0.0% 17.68sec 21754 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_void_terror melee 0 36685 2284 176.67 659 1317 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.76sec 52445 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend bile_spit 267997 70601 472 2.73 8822 17652 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.18sec 163257 149.71sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend bile_spit ticks -267997 92655 309 6.67 2780 0 6.8 33.3 0.0% 0.0% 0.0% 0.0% 47.18sec 163257 149.71sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend headbutt 267999 109555 732 12.05 3101 6202 30.1 30.1 17.5% 0.0% 0.0% 0.0% 9.81sec 156623 149.71sec
DStr_ID_Felguard DStr_ID_Felguard_vilefiend melee 0 193570 1293 43.21 1525 3050 107.8 107.8 17.7% 0.0% 0.0% 0.0% 2.71sec 276732 149.71sec
DStr_ID_Felguard DStr_ID_Felguard_darkhound fel_bite 272435 20950 1475 42.26 1778 3559 10.0 10.0 17.7% 0.0% 0.0% 0.0% 13.16sec 29951 14.21sec
DStr_ID_Felguard DStr_ID_Felguard_darkhound melee 0 36842 2593 200.84 659 1318 47.6 47.6 17.6% 0.0% 0.0% 0.0% 2.69sec 52670 14.21sec
DStr_ID_Felguard DStr_ID_Felguard_dreadstalker dreadbite 205196 210107 1950 16.12 6176 12358 29.0 29.0 17.5% 0.0% 0.0% 0.0% 21.07sec 210107 107.75sec
DStr_ID_Felguard DStr_ID_Felguard_dreadstalker melee 0 454669 4220 173.25 1242 2484 311.1 311.1 17.7% 0.0% 0.0% 0.0% 1.90sec 650004 107.75sec
DStr_ID_Felguard DStr_ID_Felguard_wild_imp fel_firebolt 104318 900866 9166 730.57 640 1279 1201.5 1196.7 17.7% 0.0% 0.0% 0.0% 0.24sec 900866 98.28sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard melee 0 36566 2330 180.43 659 1318 47.2 47.2 17.6% 0.0% 0.0% 0.0% 2.75sec 52276 15.70sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard melee_oh 0 18292 1165 180.43 329 659 47.2 47.2 17.6% 0.0% 0.0% 0.0% 2.75sec 26150 15.70sec
DStr_ID_Felguard DStr_ID_Felguard_wrathguard overhead_assault 272432 20856 1329 38.11 1777 3558 10.0 10.0 17.7% 0.0% 0.0% 0.0% 13.38sec 29817 15.70sec
DStr_ID_Felguard DStr_ID_Felguard_demonic_tyrant demonfire 270481 245137 4645 42.72 5548 11097 37.6 37.6 17.6% 0.0% 0.0% 0.0% 6.87sec 245137 52.77sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr melee 0 18144 1427 221.11 329 659 46.8 46.8 17.6% 0.0% 0.0% 0.0% 2.74sec 25939 12.71sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr melee_oh 0 9072 714 221.11 165 329 46.8 46.8 17.6% 0.0% 0.0% 0.0% 2.74sec 12970 12.71sec
DStr_ID_Felguard DStr_ID_Felguard_illidari_satyr shadow_slash 272012 28267 2224 47.71 2374 4749 10.1 10.1 17.8% 0.0% 0.0% 0.0% 13.01sec 28267 12.71sec
DStr_ID_Felguard DStr_ID_Felguard_vicious_hellhound demon_fangs 272013 29065 2814 60.51 2372 4751 10.4 10.4 17.6% 0.0% 0.0% 0.0% 12.91sec 29065 10.33sec
DStr_ID_Felguard DStr_ID_Felguard_vicious_hellhound melee 0 17797 1723 532.05 165 330 91.6 91.6 17.7% 0.0% 0.0% 0.0% 1.42sec 25443 10.33sec
DStr_ID_Felguard DStr_ID_Felguard_bilescourge toxic_bile 272167 169483 17081 366.09 2379 4757 60.6 60.5 17.7% 0.0% 0.0% 0.0% 2.08sec 169483 9.92sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra melee 0 36538 2275 176.15 659 1319 47.2 47.2 17.6% 0.0% 0.0% 0.0% 2.80sec 52235 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra melee_oh 0 18290 1139 176.15 329 659 47.2 47.2 17.7% 0.0% 0.0% 0.0% 2.80sec 26148 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash1 272172 7550 470 28.72 835 1671 7.7 7.7 17.6% 0.0% 0.0% 0.0% 18.37sec 10794 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash2 272172 7554 470 28.72 835 1672 7.7 7.7 17.7% 0.0% 0.0% 0.0% 18.37sec 10799 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash3 272172 7546 470 28.72 835 1671 7.7 7.7 17.5% 0.0% 0.0% 0.0% 18.37sec 10787 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_shivarra multislash4 272172 7580 472 28.72 835 1670 7.7 7.7 18.1% 0.0% 0.0% 0.0% 18.37sec 10837 16.06sec
DStr_ID_Felguard DStr_ID_Felguard_eye_of_guldan eye_of_guldan ticks -272131 24004 80 12.04 399 0 27.7 60.2 0.0% 0.0% 0.0% 0.0% 4.68sec 24004 10.75sec
DStr_ID_Felguard DStr_ID_Felguard_prince_malchezaar melee 0 79189 4833 78.76 3124 6237 21.5 21.5 17.9% 0.0% 0.0% 0.0% 1.61sec 113210 16.38sec
DStr_ID_Felguard DStr_ID_Felguard_prince_malchezaar melee_oh 0 39596 2417 78.76 1562 3123 21.5 21.5 17.9% 0.0% 0.0% 0.0% 1.61sec 56608 16.38sec
DStr_ID_Imp DStr_ID_Imp augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.93sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp call_dreadstalkers 104316 0 0 0.00 0 0 14.6 0.0 0.0% 0.0% 0.0% 0.0% 21.04sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp demonbolt 264178 400572 1335 9.57 7114 14231 47.0 47.9 17.7% 0.0% 0.0% 0.0% 5.80sec 400572 299.99sec
DStr_ID_Imp DStr_ID_Imp flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp hand_of_guldan 105174 329217 1097 12.55 4465 8915 62.9 62.8 17.5% 0.0% 0.0% 0.0% 4.72sec 329217 299.99sec
DStr_ID_Imp DStr_ID_Imp heed_my_call 271685 42183 141 1.45 4925 9849 7.3 7.3 17.8% 0.0% 0.0% 0.0% 36.78sec 42183 299.99sec
DStr_ID_Imp DStr_ID_Imp heed_my_call_aoe 271686 18071 60 1.45 2111 4221 7.3 7.3 17.7% 0.0% 0.0% 0.0% 36.78sec 18071 299.99sec
DStr_ID_Imp DStr_ID_Imp inner_demons 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp nether_portal 267217 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp shadow_bolt 686 394810 1316 18.67 3593 7186 94.0 93.3 17.7% 0.0% 0.0% 0.0% 3.14sec 394810 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_demonic_tyrant 265187 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 93.51sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_imp 688 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_random_demon 0 0 0 0.00 0 0 17.8 0.0 0.0% 0.0% 0.0% 0.0% 14.76sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp summon_vilefiend 264119 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 47.17sec 0 299.99sec
DStr_ID_Imp DStr_ID_Imp volatile_blood_explosion 278057 86514 288 1.44 10240 20481 7.3 7.2 17.4% 0.0% 0.0% 0.0% 36.98sec 86514 299.99sec
DStr_ID_Imp DStr_ID_Imp_imp firebolt 3110 940427 3135 20.60 7760 15515 103.8 103.0 17.7% 0.0% 0.0% 0.0% 2.89sec 940427 299.99sec
DStr_ID_Imp DStr_ID_Imp_wrathguard melee 0 36415 2317 178.95 660 1320 46.9 46.9 17.8% 0.0% 0.0% 0.0% 2.77sec 52060 15.72sec
DStr_ID_Imp DStr_ID_Imp_wrathguard melee_oh 0 18215 1159 178.95 330 659 46.9 46.9 17.8% 0.0% 0.0% 0.0% 2.77sec 26041 15.72sec
DStr_ID_Imp DStr_ID_Imp_wrathguard overhead_assault 272432 20810 1324 37.84 1779 3560 9.9 9.9 18.0% 0.0% 0.0% 0.0% 13.41sec 29751 15.72sec
DStr_ID_Imp DStr_ID_Imp_bilescourge toxic_bile 272167 169389 14563 311.54 2384 4767 60.4 60.4 17.6% 0.0% 0.0% 0.0% 2.11sec 169389 11.63sec
DStr_ID_Imp DStr_ID_Imp_vilefiend bile_spit 267997 70867 473 2.73 8825 17647 6.8 6.8 17.6% 0.0% 0.0% 0.0% 47.17sec 163773 149.83sec
DStr_ID_Imp DStr_ID_Imp_vilefiend bile_spit ticks -267997 92906 310 6.69 2777 0 6.8 33.5 0.0% 0.0% 0.0% 0.0% 47.17sec 163773 149.83sec
DStr_ID_Imp DStr_ID_Imp_vilefiend headbutt 267999 109870 733 12.05 3099 6205 30.1 30.1 17.8% 0.0% 0.0% 0.0% 9.81sec 157072 149.83sec
DStr_ID_Imp DStr_ID_Imp_vilefiend melee 0 193676 1293 43.18 1526 3052 107.8 107.8 17.7% 0.0% 0.0% 0.0% 2.71sec 276883 149.83sec
DStr_ID_Imp DStr_ID_Imp_urzul many_faced_bite 272439 22475 1670 47.95 1779 3552 10.8 10.8 17.5% 0.0% 0.0% 0.0% 12.60sec 32131 13.46sec
DStr_ID_Imp DStr_ID_Imp_urzul melee 0 37143 2760 213.11 660 1319 47.8 47.8 17.7% 0.0% 0.0% 0.0% 2.77sec 53101 13.46sec
DStr_ID_Imp DStr_ID_Imp_dreadstalker dreadbite 205196 211131 1956 16.14 6176 12347 29.0 29.0 17.7% 0.0% 0.0% 0.0% 21.04sec 211131 107.93sec
DStr_ID_Imp DStr_ID_Imp_dreadstalker melee 0 455792 4223 173.27 1243 2485 311.7 311.7 17.7% 0.0% 0.0% 0.0% 1.90sec 651609 107.93sec
DStr_ID_Imp DStr_ID_Imp_wild_imp fel_firebolt 104318 912953 10220 814.70 640 1279 1217.9 1212.9 17.7% 0.0% 0.0% 0.0% 0.24sec 912953 89.33sec
DStr_ID_Imp DStr_ID_Imp_demonic_tyrant demonfire 270481 245808 4648 42.66 5561 11123 37.7 37.6 17.6% 0.0% 0.0% 0.0% 6.88sec 245808 52.88sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr melee 0 18366 1328 205.16 330 659 47.3 47.3 17.8% 0.0% 0.0% 0.0% 2.71sec 26256 13.83sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr melee_oh 0 9180 664 205.16 165 330 47.3 47.3 17.7% 0.0% 0.0% 0.0% 2.71sec 13124 13.83sec
DStr_ID_Imp DStr_ID_Imp_illidari_satyr shadow_slash 272012 28566 2066 44.33 2375 4753 10.2 10.2 17.7% 0.0% 0.0% 0.0% 12.76sec 28566 13.83sec
DStr_ID_Imp DStr_ID_Imp_darkhound fel_bite 272435 20822 1512 43.42 1779 3556 10.0 10.0 17.5% 0.0% 0.0% 0.0% 13.17sec 29768 13.77sec
DStr_ID_Imp DStr_ID_Imp_darkhound melee 0 36554 2655 205.37 659 1319 47.1 47.1 17.6% 0.0% 0.0% 0.0% 2.71sec 52259 13.77sec
DStr_ID_Imp DStr_ID_Imp_vicious_hellhound demon_fangs 272013 29253 2369 50.90 2372 4745 10.5 10.5 17.7% 0.0% 0.0% 0.0% 12.62sec 29253 12.35sec
DStr_ID_Imp DStr_ID_Imp_vicious_hellhound melee 0 17725 1435 443.15 165 330 91.2 91.2 17.6% 0.0% 0.0% 0.0% 1.40sec 25340 12.35sec
DStr_ID_Imp DStr_ID_Imp_shivarra melee 0 37128 2245 173.48 659 1319 47.8 47.8 17.7% 0.0% 0.0% 0.0% 2.71sec 53079 16.54sec
DStr_ID_Imp DStr_ID_Imp_shivarra melee_oh 0 18561 1122 173.48 330 659 47.8 47.8 17.7% 0.0% 0.0% 0.0% 2.71sec 26535 16.54sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash 272172 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 16.54sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash1 272172 7694 465 28.38 835 1672 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.58sec 10999 16.54sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash2 272172 7667 464 28.38 835 1672 7.8 7.8 17.3% 0.0% 0.0% 0.0% 17.58sec 10961 16.54sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash3 272172 7687 465 28.38 836 1668 7.8 7.8 17.7% 0.0% 0.0% 0.0% 17.58sec 10990 16.54sec
DStr_ID_Imp DStr_ID_Imp_shivarra multislash4 272172 7671 464 28.38 835 1670 7.8 7.8 17.4% 0.0% 0.0% 0.0% 17.58sec 10967 16.54sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath 272156 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 12.54sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath1 272156 22011 1755 37.82 2366 4741 7.9 7.9 17.6% 0.0% 0.0% 0.0% 16.83sec 22011 12.54sec
DStr_ID_Imp DStr_ID_Imp_void_terror double_breath2 272156 22051 1758 37.82 2367 4738 7.9 7.9 17.8% 0.0% 0.0% 0.0% 16.83sec 22051 12.54sec
DStr_ID_Imp DStr_ID_Imp_void_terror melee 0 36800 2934 226.67 660 1319 47.4 47.4 17.7% 0.0% 0.0% 0.0% 2.67sec 52611 12.54sec
DStr_ID_Imp DStr_ID_Imp_eye_of_guldan eye_of_guldan ticks -272131 25153 84 12.59 400 0 29.2 62.9 0.0% 0.0% 0.0% 0.0% 4.89sec 25153 13.72sec
DStr_ID_Imp DStr_ID_Imp_prince_malchezaar melee 0 77646 5272 85.94 3126 6242 21.1 21.1 17.8% 0.0% 0.0% 0.0% 1.45sec 111004 14.73sec
DStr_ID_Imp DStr_ID_Imp_prince_malchezaar melee_oh 0 38685 2626 85.94 1562 3129 21.1 21.1 17.3% 0.0% 0.0% 0.0% 1.45sec 55305 14.73sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
136104.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 12.87% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.33% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.88% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.34% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.89% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.09% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 13.03% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:13.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.29% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 4.39% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:4.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.90% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.90%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your $?c1[Chaos][Fire] damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 136104.80
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 4999
Mean 299.99
Minimum 240.02
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 4999
Mean 138136.62
Minimum 129478.00
Maximum 147393.59
Spread ( max - min ) 17915.59
Range [ ( max - min ) / 2 * 100% ] 6.48%
Standard Deviation 3215.6374
5th Percentile 133377.85
95th Percentile 144214.54
( 95th Percentile - 5th Percentile ) 10836.69
Mean Distribution
Standard Deviation 45.4805
95.00% Confidence Intervall ( 138047.48 - 138225.76 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2082
0.1 Scale Factor Error with Delta=300 88271
0.05 Scale Factor Error with Delta=300 353084
0.01 Scale Factor Error with Delta=300 8827096
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 4999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1276
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 32745608 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3336 3336 3336
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n